2023-2024 | Catalog

Gurnick AcademyofMedicalArtsaimstoofferqualityalliedhealthandnursingprogramsthatintegrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. Gurnick AcademyofMedicalArtsbelieveseducationshouldpromotepositiveself-esteem,providingservices that support each student’s academic, professional, and personal success. Gurnick AcademyofMedicalArtsprovidestrainingtoindividualsseekingaprofessionalcareerinthemedical field. This is accomplished through an educational format utilizing training that includes simulation mannequins,didacticlectures, and hands-on experience provided by trained academicians, nurses, physicians, andtechnologists. Abreadthofgeneraleducationcoursesisofferedtosupportthestudentinprovidingsafeandeffectivecarefor clients and families from diverse and multicultural populations across the lifespan. Gurnick Academy of Medical Arts also uses course delivery systems, including distance education and blended formats. ||||||||| | Integrate | Empower | Achieve BranchCampus BranchCampus CorporateOffice MainCampus 1401WillowPassRoad, 8810CalCenterDrive, 1641N.FirstStreet, 1641N.FirstStreet, rd Suite 450, 3 Floor, SanJose,CA95112 SanJose,CA95112 Concord,CA94520 Sacramento,CA95826 (408) 384-7060 (408) 384-7050 (925) 687-9555 (916) 588-2060 (408) 850-3747 fax (408) 850-3737 fax (925) 687-9544 fax (916) 588-2061 fax BranchCampus BranchCampus BranchCampus 4712StoddardRoad, 4747N.FirstAvenue, 15400ShermanWay, Suite 200, Suite 192, Suite 201, Modesto,CA95356 Fresno, CA 93726 VanNuys,CA91406 (209) 521-1821 (559) 222-1903 (747) 200-4567 (209) 521-1607 fax (559) 222-2672 fax (747) 477-3747 fax 2

TABLEOFCONTENTS Some photographs in this publication were not taken at Gurnick Academy of Medical Arts. However, they accurately represent the general type and quality of equipment and facilities at Gurnick Academy of Medical Arts. Please note that the Catalog without the Addendum is incomplete. The following items are located in the attached Catalog Addendum: LIST OF FACULTYANDADMINISTRATIVESTAFFMEMBERS ACADEMICCALENDAR CURRENTFEES&TUITION FROMTHECEO 10 STATEMENTOFHISTORY&OWNERSHIP 11 EXECUTIVEOFFICERSOFGURNICKACADEMYOFMEDICALARTS 14 ACADEMYLOCATIONS&GENERALDESCRIPTIONOFFACILITIES 14 PROGRAMOFFERINGS 17 ACCREDITATION,APPROVAL,RECOGNITION,MEMBERSHIP 18 Associate of Occupational Science in Respiratory Care Program 19 Associate of Occupational Science in Radiologic Technology Program 19 Associate of Occupational Science in Ultrasound Technology Program 19 Associate of Occupational Science in Vascular Ultrasound Technology Program 20 Associate of Science in MRI Program 20 Associate of Science in Nursing Program 20 Associate of Science in Physical Therapist Assistant Program 20 Bachelor of Science in Nursing Program 20 Dental Assistant Program 20 IV Therapy and Blood Withdrawal Course 20 Vocational Nurse Program 20 X-ray Technician with Medical Assistant Skills Program 21 State Authorization 21 OtherApprovalsandMemberships 21 ADMISSIONPOLICIES 22 PREREQUISITES,COREQUISITES,&ADMISSIONCOURSES 22 REGISTRATIONFEE 22 INTERNATIONALSTUDENTADMISSIONS 23 ABILITY TO BENEFIT 23 ADMISSIONREQUIREMENTS 23 GeneralAdmissionRequirementsforallPrograms 26 Additional Admission Requirements per Program 27 Associate of Occupational Science in Cardiac Ultrasound Technology Program (A.O.S. in CUT) 27 Associate of Occupational Science in Respiratory Care Program (A.O.S. in RC) 29 Associate of Occupational Science in Radiologic Technology Program (A.O.S. in RT) 30 Associate of Occupational Science in Ultrasound Technology Program (A.O.S. in UT) 32 Associate of Occupational Science in Vascular Ultrasound Technology Program (A.O.S. in VUT) 33 Associate of Science in Magnetic Resonance Imaging Program (A.S. in MRI) 34 Associate of Science in Nuclear Medicine Technology Program (A.S. in NM) 36 Associate of Science in Nursing Program (ADN) 37 3

Associate of Science in Physical Therapist Assistant Program (A.S. in PTA) 41 Associate of Science in Radiologic Technology Program (A.S. in RT) 43 Associate of Science in Vocational Nursing Program (A.S. in VN) 45 Bachelor of Science in Diagnostic Medical Imaging Program (B.S. in DMI) 45 Bachelor of Science in Nursing Program (BSN) 46 Bachelor of Science in Radiation Therapy Program (B.S. in RT) 50 BoneDensitometryTechnicianProgram(DXA) 51 Dental Assistant Program (DA) 53 MedicalAssistant Program (MA) 53 MasterofScienceinNursingProgram(BSNtoMSNPathway) 53 Vocational Nurse (VN) Program 54 X-ray Technician with Medical Assistant Skills Program (XTMAS) 56 MinimumRequirementsforStudentsEnrollinginDistanceEducationCourses 58 PERFORMANCEREQUIREMENTS 59 Program-Specific Performance Requirements 60 Associate of Occupational Science in Cardiac Ultrasound Technology Program (A.O.S. in CUT) 60 Associate of Occupational Science in Respiratory Care Program (A.O.S. in RC) 60 Associate of Occupational Science in Radiologic Technology Program (A.O.S. in RT) 61 Associate of Occupational Science in Ultrasound Technology Program (A.O.S. in UT) 62 Associate of Occupational Science in Vascular Ultrasound Technology Program (A.O.S. in VUT) 63 Associate of Science in Magnetic Resonance Imaging Program (A.S. in MRI) 63 Associate of Science in Nuclear Medicine Technology Program (A.S. in NM) 64 Associate of Science in Nursing Program (ADN) 65 Associate of Science in Physical Therapist Assistant Program (A.S. in PTA) 66 Associate of Science in Radiologic Technology Program (A.S. in RT) 67 Bachelor of Science in Nursing Program (BSN) 68 Bachelor of Science in Radiation Therapy Program (B.S. in RT) 68 BoneDensitometryTechnicianProgram(DXA) 69 MedicalAssistant Program (MA) 70 X-Ray Technician with Medical Assistant Skills Program (XTMAS) 71 RE-ENROLLMENT 72 FOREIGNTRANSCRIPT/DIPLOMAEVALUATIONS 72 IMMUNIZATIONREQUIREMENTS 73 HEALTHSCREENINGREQUIREMENTS 74 BACKGROUNDCHECK 74 CPR 74 CLINICALFACILITIES 75 TRAVELDISCLOSURE 75 ADVANCEDPLACEMENT&CREDITGRANTING 75 ProgramSpecific Placement &Credit Granting 76 Associate of Occupational Science in Cardiac Ultrasound Technology Program (A.O.S. in CUT) 76 Associate of Occupational Science in Respiratory Care Program (A.O.S. in RC) 76 Associate of Occupational Science in Radiologic Technology Program (A.O.S. in RT) 76 Associate of Occupational Science in Ultrasound Technology Program (A.O.S. in UT) 76 Associate of Occupational Science in Vascular Ultrasound Technology Program (A.O.S. in VUT) 76 Associate of Science in Magnetic Resonance Imaging Program (A.S. in MRI) 77 4

Associate of Science in Nursing Program (ADN) 77 Associate of Science in Physical Therapist Assistant Program (A.S. in PTA) 78 Associate of Science in Radiologic Technology Program (A.S. in RT) 78 Bachelor of Science in Diagnostic Medical Imaging (B.S. in DMI) 78 Bachelor of Science in Nursing Program (BSN) 78 Vocational Nurse (VN) Program 79 LICENSURE,CERTIFICATION,®ISTRYDISCLAIMER 79 ProgramsSpecific Licensure, Certification & Registry Disclaimer 80 Associate of Occupational Science in Cardiac Ultrasound Technology Program (A.O.S. in CUT) 80 Associate of Occupational Science in Respiratory Care Program (A.O.S. in RC) 81 Associate of Occupational Science in Radiologic Technology Program (A.O.S. in RT) 82 Associate of Occupational Science in Ultrasound Technology Program (A.O.S. in UT) 83 Associate of Occupational Science in Vascular Ultrasound Technology Program (A.O.S. in VUT) 84 Associate of Science in MRI Program (A.S. in MRI) 84 Associate of Science in Nuclear Medicine Technology Program (A.S. in NM) 84 Associate of Science in Nursing Program (ADN) 85 Associate of Science in Physical Therapist Assistant Program (A.S. in PTA) 86 Associate of Science in Radiologic Technology Program (A.S. in RT) 87 Bachelor of Science in Radiation Therapy Program (B.S. in RT) 89 Bachelor of Science in Nursing Program (BSN) 90 BoneDensitometryTechnicianProgram(DXA) 91 Dental Assistant Program (DA) 91 MedicalAssistant Program (MA) 91 Vocational Nurse Program (VN) 91 X-ray Technician with Medical Assistant Skills Program (XTMAS) 94 PASSPROGRAM 94 FINANCIALPOLICIES 95 ALUMNIGRANTS&SCHOLARSHIP 95 FEEANDTUITIONINFORMATION 95 REFUND 96 Student’s Right to Cancel 96 WithdrawalfromtheProgram 96 GRADUATESURVEYSANDPLACEMENTDATA(GSPD) 97 STUDENTTUITIONRECOVERYFUND 97 FINANCIALAIDINFORMATION 98 HOWTOAPPLYFORFINANCIALAID 99 GENERALSTUDENTELIGIBILITYREQUIREMENTS 99 FEDERALFINANCIALAIDPROGRAMS 100 CALGRANT 103 LOANENTRANCEANDEXITCOUNSELING 104 STUDENTLOANCODEOFCONDUCT 105 SALLIE MAELOANS 106 COLLEGEAVE 107 VETERANSBENEFITS&VETERANSADMINISTRATIONAPPLICANTSADDITIONALINFORMATION 107 AIDDISBURSEMENT&SATISFACTORYACADEMICPROGRESS(SAP) 108 ONLINESTUDENTS 111 5

RETURNOFNON-TITLEIVFUNDS 112 WITHDRAWALS&THERETURNTOTITLEIVAID(R2T4)CALCULATION 112 ADMINISTRATIVEPOLICIES 113 CATALOGPOLICIES 113 PROGRAMPOLICIES 113 INDIVIDUALRESPONSIBILITY 114 ACADEMICFREEDOM 114 NON-DISCRIMINATION 114 Harassment/Title IX Coordinator 114 Sexual Harassment 115 Anti-Bullying/Anti-Harassment 115 Sexual Assault Prevention and Response 115 Reporting a Sexual Assault 117 Counseling 117 SexOffenderRegistry 117 STUDENT’SRIGHTTOPRIVACY 117 STUDENTRECORDS 118 TRANSCRIPTS 119 STUDENTCODEOFCONDUCT 119 SAFETY&CAMPUSSECURITY 120 Access 120 CampusResidences 120 CampusPoliceAuthorityandJurisdiction 120 CrimePreventionPrograms 120 Security Awareness Programs 120 Timely Warnings 121 AnnualDisclosureofCrimeStatistics 121 CrimeReporting 122 Personal Property 122 Incident/Accident Reporting 122 WeaponsandFirearms 123 NeedleStick 123 CommunicableDisease 124 Federal Law Concerning Chemical Hazards 124 DRUG-FREE 125 Drug-Free Campus 125 DrugandAlcoholPrevention 125 Applicability 125 Prohibited Behavior 125 Notification of Convictions 125 Consequences 126 Assistance 126 Resources 126 Confidentiality 127 SharedResponsibility 127 ReasonableSuspicionTesting 127 6

Communication 127 ReviewofthisPolicy 127 Alcoholic Beverage Programs 128 Illegal Drugs 128 Prevention Programs 128 Local, State, and Federal Legal Sanctions 128 PREGNANCY 130 STUDENTBEREAVEMENT 132 CHANGEOFNAME 133 STUDENTDRESSCODE 133 CELLPHONE 134 ADMINISTRATIONOFEXAMINATION 134 ELECTRONICRECORDING 135 VIDEOANDAUDIOSURVEILLANCENOTIFICATION 135 TRANSFER 135 TRANSFERABILITYOFCREDITSANDCREDENTIALS 136 UNITOFCREDIT 136 ESTIMATEDTIMEFOROUTSIDE-OF-SCHOOLPREPARATIONHOURS(OSPH) 136 STUDENTGRIEVANCEANDAPPEALS 137 COPYRIGHT 138 FILE SHARING 140 PLAGIARISM 140 STUDENTSERVICES 141 StudentIdentification Card 141 AcademicAdvisement 141 Accessibility for Disabled Students 141 Orientation of New Students 141 Tutor Locator Service 141 Library Resources 141 ComputerandInternetResources 142 StudentInformationSystem 142 EmploymentAssistance 142 Housing 143 StudentResources 143 Learning Disabilities 143 Disability Accommodation & Grievance Policy 144 ConsumerProtection 146 ACADEMICINTEGRITY 147 PROGRAMDELIVERY 148 ELECTRONICBOOKS 148 GENERALEDUCATION,TECHNICALEDUCATION&PROFESSIONALEDUCATION 149 ENGLISHINSTRUCTION 149 STANDARDSOFSATISFACTORYACADEMICPROGRESS 149 Qualitative Measurements 149 Quantitative Measurements 151 CLASSSTANDING 153 7

ATTENDANCE–ABSENT–TARDINESS–DROP 153 Make-upGuidelines 155 ACADEMICPROBATION/REMEDIATION 157 DISCIPLINARYPROBATION 160 REPETITIONOFCLASSESORMODULES 161 LEAVESOFABSENCE 161 Pregnancy 161 Academic 162 GRADUATIONREQUIREMENTS 162 Program-Specific Graduation Requirements 162 ONLINECOURSERESPONSETIME 163 STUDENTTECHNOLOGYACCEPTABLEUSEPOLICIES 163 VIOLATIONOFCOMPUTERUSEPOLICYANDRULES 163 REQUIREDAPPLICATIONS 163 ACCEPTABLEUSES 164 PROHIBITEDUSES 164 NOEXPECTATIONOFPRIVACY 164 EMAILUSAGE 164 SystemMonitoring 164 Email Accounts 165 PrimaryMeansofCommunication 165 Legal Risks 165 Confidential Information 165 Acceptable Use 165 Best Practices 166 EquipmentLossesandDamages 167 StudentTechnologySecurityPolicy 167 TheImportanceofStrongandSecurePasswords 167 PROGRAMINFORMATION 170 ASSOCIATEOFOCCUPATIONALSCIENCEINCARDIACULTRASOUNDTECHNOLOGYPROGRAM(A.O.S.inCUT) 171 ASSOCIATEOFOCCUPATIONALSCIENCEINRESPIRATORYCAREPROGRAM(A.O.S.INRC) 174 ASSOCIATEOFOCCUPATIONALSCIENCEINRADIOLOGICTECHNOLOGYPROGRAM(A.O.S.INRT) 177 ASSOCIATEOFOCCUPATIONALSCIENCEINULTRASOUNDTECHNOLOGYPROGRAM(A.O.S.inUT) 180 ASSOCIATEOFOCCUPATIONALSCIENCEINVASCULARULTRASOUNDTECHNOLOGYPROGRAM(A.O.S.inVUT) 184 ASSOCIATEOFSCIENCEINMAGNETICRESONANCEIMAGINGPROGRAM(A.S.inMRI) 187 ASSOCIATEOFSCIENCEINNUCLEARMEDICINETECHNOLOGYPROGRAM(A.S.inNM) 189 ASSOCIATEOFSCIENCEINNURSINGPROGRAM(ADN) 192 ASSOCIATEOFSCIENCEINPHYSICALTHERAPISTASSISTANTPROGRAM(A.S.inPTA) 198 ASSOCIATEOFSCIENCEINRADIOLOGICTECHNOLOGYPROGRAM(A.S.INRT) 201 ASSOCIATEOFSCIENCEINVOCATIONALNURSINGPROGRAM(A.S.inVN) 205 BACHELOROFSCIENCEINDIAGNOSTICMEDICALIMAGINGPROGRAM(B.S.inDMI) 206 BACHELOROFSCIENCEINNURSINGPROGRAM(BSN) 209 BACHELOROFSCIENCEINRADIATIONTHERAPY(B.S.inRT) 218 BONEDENSITOMETRYTECHNICIANPROGRAM(DXA) 221 DENTALASSISTANTPROGRAM(DA) 222 MASTEROFSCIENCEINNURSINGPROGRAM(BSNtoMSN) 224 8

MEDICALASSISTANTPROGRAM(MA) 227 VOCATIONALNURSEPROGRAM(VN) 229 X-RAYTECHNICIANWITHMEDICALASSISTANTSKILLS(XTMAS) 232 CONTINUINGEDUCATIONANDONLINEPREREQUISITECOURSES 234 ONLINEEDUCATIONPREREQUISITECOURSES 234 CONTINUINGEDUCATIONCOURSES 234 CPRCourseforBasicLifeSupport 234 Diagnostic Medical Imaging Advanced Clinical Practicum 235 Essential Medical Bioscience (EMB) 236 IV Therapy/Blood Withdrawal Course 237 International Nurse Graduate Courses (ING) 240 MagneticResonanceImaging(MRI)Intravenous(IV)BloodWithdrawalCourse 245 Nursing Transition Advanced Placement Theory & Lab Course 247 COURSEDESCRIPTIONS 248 POLICIES SPECIFIC TO NEVADASTUDENTS 320 ACADEMYLOCATIONS&GENERALDESCRIPTIONOFFACILITIES 320 ACCREDITATION,APPROVAL,RECOGNITION,MEMBERSHIP 320 LICENSURE,CERTIFICATION,®ISTRYDISCLAIMER 320 ProgramsSpecific Licensure, Certification & Registry Disclaimer 321 Associate of Science in MRI Program (A.S. in MRI) 321 REFUND 321 ACCOUNTFORSTUDENTINDEMNIFICATION 322 DRUG-FREE 322 Local, State, and Federal Legal Sanctions 322 PREGNANCY 322 STUDENTGRIEVANCEANDAPPEALS 323 STUDENTSERVICES 325 ConsumerProtection 325 PROGRAMDELIVERY 325 COURSEDESCRIPTIONS 325 NOTE:PleasereviewtheattachedAddendumforanychangesregardingGurnickAcademyofMedicalArts. All information in the Gurnick Academy of Medical Arts Catalog and Catalog Addendum applies to all AcademyCampusesunlessidentifiedbyspecificcampuslocation. The Addendum includes new programs and updates after the 2023-2024 Catalog’s original publishing date. ThecatalogwaspublishedonJanuary1,2024. ThepurposeoftheAddendumistoprovidethemostup-to-dateinformation. 9

FROMTHECEO DearStudent, WelcometoGurnickAcademyofMedicalArts! Onbehalfofmystaffandfaculty,IwouldliketothankyouforyourinterestinGurnickAcademyofMedicalArts. Gurnick Academy of Medical Arts opened its first campus in February 2004. As we celebrate our 20th anniversary this year, six (6) campuses in California and several extensive allied health and nursing programs are offered; we also offer some programs via online and hybrid educational delivery methods. We are excited to offer certificate, diploma, and degree (up to Master) level programs. More than 3,500 students are served annually. Your decision to join Gurnick Academy of Medical Arts could lead you to a rewarding and fulfilling career in the medicalfield. Our catalog describes our programs, admission and graduation requirements, policies, and other essential information to help you decide on your course of study and progress academically and administratively in your chosenprogram. Gurnick Academy of Medical Arts is a private academy offering quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to develop and achieve their personal and career goals. Our programs provide our students with in-depth knowledge and hands-on experience in the medical industry. At Gurnick Academy of Medical Arts, we consider the clinical part of our students’ training one of the most critical aspects of their medical education. Our students must rotate throughout our affiliated medical facilities while attending Gurnick Academy of Medical Arts. The number of clinical hours varies with each program. Gurnick Academy of Medical Arts is continuously improving its operations and quality level. We are proud of what has been accomplished in the past years, and we look forward to sharing our future progress with you as wecontinuetoaddresstheneedsofourstudentsthroughmyriadinnovativetechniques. Konstantin Gourji Chief Executive Officer 10

STATEMENTOFHISTORY&OWNERSHIP February2024 ABHESapprovestheBoneDensitometryTechnicianprogramattheSacramentocampus. December2023 ABHESapprovestheAssociateofOccupationalScienceinRespiratoryCareprogramattheModestocampus. November2023 CommissiononAccreditationofAlliedHealthEducationProgram(CAAHEP)grantsourAssociateof Occupational Science in Ultrasound Technology Program Abdominal-Extended and Obstetrics and Gynecology concentrations accreditation at our Sacramento Campus. October2023 TheMedicalAssistantprogramhasbeendiscontinuedatourSacramentocampus. March2023 ABHES approves the Associate of Occupational Science in Cardiac Ultrasound Technology program at our San MateoandSacramentocampuses. January2023 The Medical Assistant program and Associate of Science in Veterinary Medical Technology program have been discontinued at the San Mateo campus. ThePsychiatric Technology program has been discontinued at our Concord campus. November2022 ABHES approves the Associate of Occupational Science in Vascular Ultrasound Technology program at the San Mateocampus. August2022 ABHESapprovestheMasterofScienceinNursingprogramattheConcordcampus. June2022 ABHESapprovestheBachelorofScienceinRadiationTherapyprogramattheVanNuyscampus. November2021 The Joint Review Committee on Education in Radiologic Technology (JRCERT) grants the Associate of Science in Radiologic Technology Program accreditation at our Sacramento Campus with an 8-year award. September2021 ABHESapprovesourConcordCampus’sAssociateofScienceinNuclearMedicineTechnologyProgram. CommissiononAccreditationofAlliedHealthEducationProgram(CAAHEP)grantsourAssociateof Occupational Science in Ultrasound Technology Program Abdominal-Extended and Obstetrics and Gynecology concentrations accreditation at our San Mateo Campus. TheMedicalAssistantwithPhlebotomyprogramhasbeendiscontinuedatourConcordandFresnocampuses. June2021 ABHESapprovestheVocationalNurseProgramatourSacramentoCampus. 11

May2021 The Commission on Accreditation of Allied Health Education Program (CAAHEP) grants our Associate of Occupational Science in Ultrasound Technology Program Vascular concentration accreditation at our San Mateo Campus. October2020 TheDentalAssistantprogramhasbeendiscontinuedatourSanMateocampus. August2020 ABHES approves a credential change from Associate of Science to Associate of Occupational Science in Ultrasound Technology. May2020 ABHESapprovestheX-rayTechnicianwithMedicalAssistantSkillsProgramontheConcordCampus. December2019 ABHESapprovestheX-rayTechnicianwithMedicalAssistantSkillsProgramatourSacramentoCampus. Commission on Accreditation in Physical Therapy Education (CAPTE) reaffirms accreditation for ten (10) additional years. September2019 ABHESapprovestheMedicalAssistantProgramatourVanNuysCampus. June2019 Joint Review Committee on Education in Radiologic Technology (JRCERT) grants the Associate of Occupational Science in Radiologic Technology Program accreditation at our Van Nuys Campus with an 8-year award. March2019 ABHESapprovesVanNuysCampus. ABHESapprovestheX-rayTechnicianwithMedicalAssistantSkillsProgramatourVanNuysCampus. ABHESapprovestheAssociateofOccupationalScienceinRadiologicTechnologyProgramatourVanNuys Campus. December2018 ABHES and the California Board of Registered Nurses approved International Nurse Graduate Courses at our FresnoCampus. November2018 The Joint Review Committee on Education in Radiologic Technology (JRCERT) grants accreditation to the Associate of Science in Radiologic Technology Program at our Sacramento Campus. February2018 The California Board of Registered Nurses (BRN) approves the Associate of Science in Nursing Program at the FresnoCampus. August2017 ABHESapprovestheDentalAssistantProgramattheModestoCampus. January2017 ABHESapprovestheSacramentoCampus. 12

ABHES approves the Medical Assistant, Associate of Science in Magnetic Resonance Imaging, Associate of Science in Radiologic Technology, and Associate of Science in Ultrasound Technology Programs at the SacramentoCampus. November2016 ABHESapprovestheAssociateofScienceinNursingProgramattheFresnoCampus. December2015 ABHESapprovestheBachelorofScienceinDiagnosticMedicalImagingProgram. October2015 ABHESapprovestheDentalAssistantProgramattheSanMateoCampus. January2015 ABHESapprovesourConcordCampus’sAssociateofScienceinRadiologicTechnologyProgram. ABHES approves the Associate of Science in Ultrasound Technology Program at the Fresno and San Mateo Campuses. December2014 TheCommissiononAccreditationinPhysicalTherapyEducation(CAPTE)grantsthePTAProgramaccreditation. September2014 ABHESapprovestheAssociateofScienceinMagneticResonanceImagingProgramattheSanMateoCampus. July 2014 ABHESapprovestheBachelorofScienceinNursingDegreeProgramattheConcordCampus. January2014 TheAmericanRegistryofRadiologicTechnologies®(ARRT®)recognizestheMRI,RT,andUTprograms. September2013 ABHESapprovestheMedicalAssistantProgramattheConcord,Fresno,Modesto,andSanMateoCampuses. August2013 ABHESaccreditsGurnickAcademyforamaximumeight(8)yeartimeframethroughFebruary28,2022. May2013 ABHESapprovestheAssociateofScienceinMagneticResonanceImagingProgramattheModestoCampus. February2013 ABHESapprovestheAssociateofScienceinPhysicalTherapistAssistantProgram. March2010 The Joint Review Committee on Education in Radiologic Technology (JRCERT) grants accreditation to the RT Program. December2009 The Accrediting Bureau of Health Education Schools (ABHES) grants Gurnick Academy Institutional Accreditation. 13

June2008 TheConcordCampusoffersanRTProgram. November2007 TheFresnoandModestoCampusesofferaVNProgram. December2005 TheConcordCampusoffersaVNProgram. January2005 TheSanMateoCampusoffersVNandMRITechnologyPrograms. February2004 TheSanMateoCampusoffersaUTProgram. Gurnick Academy of Medical Arts is owned and operated by California Limited Liability Company Gurnick AcademyofMedicalArts,LLC.TheaddressfortheLLCis1641N.FirstStreet,SanJose,CA95112. EXECUTIVEOFFICERSOFGURNICKACADEMYOFMEDICALARTS Konstantin Gourji, Chief Executive Officer Larisa Revzina, Chief Academic Officer Zara J. Gourji, Chief Process Officer BurkeMalin,ChiefOperatingOfficer ElenaKudrya,VicePresident,Finance FredFaridian, Vice President, Campus Operations JamesMurrell,DeanofImaging SamanthaManlosaSanchez,DeanofNursing Lisa Dianda, Interim Dean of Allied Health ACADEMYLOCATIONS&GENERALDESCRIPTIONOFFACILITIES Thestudentenrollmentagreementsstateallclassesaretaughtatthecampuslocationsbelow. SanJoseMainCampus 1641NorthFirstStreet SanJose,CA95112 (408) 384-7050 (408) 850-3737 fax The San Jose campus is in a 40,000-square-foot two-floor professional building minutes from the San Jose MinetaInternational Airport. The first floor houses the administrative offices, while the second floor houses eight (8) classrooms and nine (9) labs. Labs are equipped with ultrasound machines capable of performing general and specialized procedures, hi-lo treatment tables, exercise equipment, hospital beds, mannequins, and equipment for examination and diagnostic assistance, including scales, EKG machines, and urine and blood testing. 14

The nursing interactive simulation room contains four (4) specialty rooms with high-fidelity mannequins controlled through an observation room utilizing a two-way communication system and cameras. There are also administrative and faculty offices, a reception area, and a student lounge. The San Jose campus employs a security system incorporating internal and external cameras, an intercom system, and loudspeakers throughout the facility. All doors and offices are protected through a network of wireless access controls. The campus also utilizes security guard and security patrol services. Plenty of parking is available on campus grounds. The First Street & I-280 San Jose Airport parking lot is behind thecampus. ConcordBranchCampus 1401WillowPassRoad,Suite450 Concord,CA94520 (925) 687-9555 (925) 687-9544 fax TheConcordbranch,includingcampusadministrationandthefrontdesk,islocatedonthefourthfloorofa professional building The sixth and eighth floors are held exclusively for the BSN program. A few steps away across the street, the campus also houses the Medical Assistant Program at a campus extension. Thecampushousesclassrooms,apatient-carelab,amedicalassistant/phlebotomylab,anRTX-raylab,a computerlab,andalibrarywithInternetaccess.Thereareadministrativeandfacultyoffices,areceptionarea, andastudentlounge.Standardequipmentincludesalibraryoftext/casestudiesandreferencebooks,video monitors, computers, journals, and audiovisual aids. Thepatient-care lab has hospital beds, anatomical models, high-fidelity interactive simulation mannequins, and other patient-care equipment. The medical assistant lab has exam tables and equipment for examination and diagnostic assistance, including scales, EKG machines, and urine and blood testing. The energized radiologic technology lab has one stationary radiography unit, a digital image receptor system, and a portable X-ray machine.Thephlebotomylabhasanatomicalchartsandmodels,specimencollectionequipment,andsupplies. ConcordExtendedFacility 1465CivicCourt,Suite820 Concord,CA.94520 TheExtendedConcordCampusisat1465CivicCourt,BuildingD,Concord,CA94520.Thebuildingislessthan 0.1 miles (0.16 km) from the campus’s main building. The extended campus occupies the second floor and housesastudentlounge,amedicalassistantLab,two(2)classrooms,andadministrativeoffices. ModestoBranchCampus 4712StoddardRoad,Suite200 Modesto,CA95356 (209) 521-1821 (209) 521-1607 fax The Modesto branch is located on the second floor of a professional building complex. The campus houses classrooms, a patient-care lab, a medical assistant lab, a dental lab, and a library with Internet access. There are administrative and faculty offices, a reception area, and two student lounges. 15

The patient-care lab has hospital beds, anatomical models, high-fidelity interactive simulation mannequins, and other patient-care equipment. The medical assistant lab has exam tables and equipment for examination and diagnostic assistance, including scales, EKG machines, and urine and blood testing. The dental lab has dental equipmentandsimulatesadentalclinic. FresnoBranchCampus 4747N.FirstAvenue,Suite192 Fresno, CA 93726 (559) 222-1903 (559) 222-2672 fax The Fresno Branch Campus is located at 4747 N First Street in the First Professional Office Complex, comprising five (5) stand-alone buildings ranging from 5,000 to 8,000 square feet (743.22 m²) each for a total of approximately 28,000 square feet (2,601.29 m²). These buildings surround an open courtyard with green space andpatioseatingfortheGurnickAcademyofMedicalArts,Fresnocommunity. A spacious student lounge is next to the patio area, with affordable snacks and drinks for our students’ convenience. Our new Simulation Learning Center houses a nursing skills lab with hospital beds, anatomical models, and other patient-care equipment. The adjoining space is set up to look like a hospital setting and is equippedwithhigh-fidelity interactive simulation mannequins that provide realistic patient care scenarios. The Ultrasound Imaging Lab has ultrasound machines capable of performing general and specialized procedures, including color Doppler and power Doppler imaging. Administrative offices are near the campus center, and Student & Career Services has a separate office suite near the parking lot. SacramentoBranchCampus rd 8810CalCenterDrive,3 Floor Sacramento,CA95826 (916) 588-2060 (916) 588-2061 fax TheSacramentobranchisonthethirdfloorofaprofessionalbuildingcomplex.Thecampushousesclassrooms, anX-raylab, an ultrasound imaging lab, a medical assistant lab, a nursing skills lab, and a nursing simulations lab. Themedicalassistantlabhasexamtablesandequipmentforexaminationanddiagnosticassistance,including scales, EKG machines, and urine and blood testing. X-ray labs include a simulation lab, an energized lab with a digital image receptor, a C-arm, a mammography machine, and a portable X-ray machine(s). Thenursingskills lab serves our vocational nursing students to help them learn in a safe and supportive setting. Thelabhashospitalbeds,anatomicalmodels,high-fidelityinteractive simulation mannequins, and other patient-care equipment. Theultrasoundimaginglabhasultrasoundmachinescapableofperforminggeneral,cardio,andspecialized procedures, including color Doppler and power Doppler imaging. Thefacility has lab and didactic rooms for each program, with all required equipment and supplies to commenceeachprogram,officesforstaff,management,andeducation,andafacultylounge.Astudy 16

hall/resource room, student lounge, conference room, storage, restrooms, and reception area are present and documentedinthefloorplan. VanNuysBranchCampus 15400ShermanWay,Suite201 VanNuys,CA91406 (747) 200-4567 (747) 477-3747 fax TheVanNuysbranchisonthesecondfloorofaprofessionalbuilding,whichhousesclassrooms,labs, administrative offices, and student support offices. There are four (4) energized X-ray labs, and two (2) medical assistant labs. The reception area is located just off the elevators. Adjacent to the reception area are administrative and student support offices. A student lounge and library are located down the hall. Eachprogramhasfacultyofficesnearthelabandclassroomareas.Standardequipmentincludesalibraryof text/case studies, reference books, journals, and computers to access the e-library. Themedicalassistantlabhasexamtablesandequipmentforexaminationanddiagnosticassistance,including scales, EKG machines, and urine and blood testing. The energized X-ray labs have four stationary radiography units, a digital image receptor system, a mammography machine, and a portable X-ray machine. Thefacility has lab and didactic rooms for each program, with all required equipment and supplies to commenceeachprogram,officesforstaff,management,andeducation,andafacultylounge.Astudy hall/resource room, student lounge, conference room, storage, restrooms, and reception area are planned and documentedinthefloorplan. PROGRAMOFFERINGS Kindly note that not all programs are available at each campus. For more details, please see the Program Offerings per Campus (Table 1). Table 1. Program Offerings per Campus ProgramTypesandNames CampusLocation DegreePrograms Associate of Occupational Science in Cardiac Ultrasound Technology Sacramento,SanJose (A.O.S. in CUT) Associate of Occupational Science in Radiologic Technology (A.O.S. in RC) Modesto Associate of Occupational Science in Radiologic Technology (A.O.S. in RT) VanNuys Associate of Occupational Science in Ultrasound Technology Fresno, Sacramento, San Jose (A.O.S. in UT) Associate of Occupational Science in Vascular Ultrasound Technology SanJose (A.O.S. in VUT) Modesto,Sacramento,San Associate of Science in Magnetic Resonance Imaging (A.S. in MRI) Jose 17

Concord(viaDistance Associate of Science in Nuclear Medicine Technology (A.S. in NM) Education) Associate of Science in Nursing (ADN) Fresno Associate of Science in Nursing (LVN to ADN) Fresno Associate of Science in Physical Therapist Assistant (A.S. in PTA) SanJose Associate of Science in Radiologic Technology (A.S. in RT) Concord,Sacramento Associate of Science in Vocational Nursing (A.S. in VN) Fresno Concord(viaDistance Bachelor of Science in Diagnostic Medical Imaging (B.S. in DMI) Education) Bachelor of Science in Nursing (BSN) Concord Bachelor of Science in Nursing (LVN to BSN) Concord Concord(viaDistance Bachelor of Science in Nursing (RN to BSN) Education) VanNuys(viaDistance Bachelor of Science in Radiation Therapy (B.S. in RT) Education) Concord(viaDistance MasterofScienceinNursing(BSNtoMSN) Education) DiplomaPrograms Concord,Sacramento,Van X-ray Technician with Medical Assistant Skills (XTMAS) Nuys Concord,Fresno,Modesto, Vocational Nurse (VN) Sacramento,SanJose Certificate Programs BoneDensitometryTechnician(DXA) Sacramento Dental Assistant (DA) Modesto MedicalAssistant (MA) Concord,Fresno,Modesto International Courses International Nurse Graduate Course (ING) Fresno Continuing Education Courses CPRCourseforBasicLifeSupport(CPR) All Concord,Fresno,Modesto, IV Therapy/Blood Withdrawal Course (IVBW) Sacramento,SanJose LVNtoRNTransitionTheory&LabCourse Concord,Fresno Concord,Fresno,Modesto, Essential Medical Bioscience (EMB) SanJose MagneticResonanceImaging(MRI)Intravenous(IV)BloodWithdrawal SanJose Course Diagnostic Medical Imaging (DMI) Advanced Clinical Practicum Concord 18

ACCREDITATION,APPROVAL,RECOGNITION,MEMBERSHIP Gurnick Academy of Medical Arts holds institutional accreditation by the Accrediting Bureau of Health Education Schools (ABHES). ABHES accreditation does not include continuing education or international courses. ABHES is located at 6116 Executive Blvd., Suite 730, North Bethesda, MD, 20852, (301) 291-7550. Gurnick Academy of Medical Arts is a private institution approved to operate by the California Bureau for Private Postsecondary Education. Approval to operate means the institution complies with the minimum standards in the California Private Postsecondary Education Act (CPPEA) of 2009 (as amended) and Division 7.5 of Title 5 of the California Code of Regulations. CPPEA is governed by the Bureau for Private Postsecondary Education; information about the Bureau can be found at www.bppe.ca.gov. The BPPE is located at 1747 N. MarketBlvd.Suite225,Sacramento,CA95834,916.574.8900. The Office of Student Assistance and Relief is available to support prospective students, current students, or past students of private postsecondary educational institutions in making informed decisions, understanding their rights, and navigating available services and relief options. The office may be reached by calling (888) 370-7589,option#5,orvisitingosar.bppe.ca.gov. Associate of Occupational Science in Respiratory Care Program Gurnick Academy of Medical Arts is seeking CoARC accreditation for a respiratory program. However, Gurnick Academy of Medical Arts does not assure that CoARC will grant accreditation. For more information about CoARC, please visit www.coarc.com. Contact information for Commission on Accreditation for Respiratory Care (CoARC): 264 Precision Blvd., Telford, TN 37690, (817) 283-2835. Associate of Occupational Science in Radiologic Technology Program The Associate of Occupational Science in Radiologic Technology Program is approved by the California Department of Public Health, Radiologic Health Branch (CDPH-RHB) as a radiographer school. Contact Information for CDPH-RHB is P.O. Box 997414, MS 7610, Sacramento, CA 95899-7414, (916) 327-5106. This program is also programmatically accredited by the Joint Review Committee on Education in Radiologic Technology (JRCERT). Contact information for The Joint Review Committee on Education in Radiologic Technology is 20 North Wacker Drive, Suite 2850, Chicago, Illinois 60606-3182, (312) 704-5300, email: [email protected], www.jrcert.org. The Associate of Occupational Science in Radiologic Technology Program is recognized by the American Registry of Radiologic Technologists® (ARRT®) – www.arrt.org/Education/Educational-Programs. Graduates from the above-mentioned programs can sit for the ARRT® (R). Anyone taking an examination offered by ARRT® and who graduates on or after January 1, 2015, must hold, at a minimum, an earned associate degree. For more information about ARRT®, please visit www.arrt.org. ARRT® is located at ARRT®, 1255 Northland Drive, St. Paul, MN55120,Phone:651-687-0048. Associate of Occupational Science in Ultrasound Technology Program The Associate of Occupational Science in Ultrasound Technology Program is recognized by the American Registry of Radiologic Technologists® (ARRT®) – www.arrt.org/Education/Educational-Programs. Graduates from the programs, as mentioned above, are eligible to sit for ARRT® (S). Anyone taking an examination offered by ARRT® and who graduates on or after January 1, 2015, must hold, at a minimum, an earned associate’s degree. For more information about ARRT®, please visit www.arrt.org. ARRT® is located at ARRT®, 1255 Northland Drive, St. Paul, MN 55120, Phone: 651-687-0048. The Associate of Occupational Science in Ultrasound Technology Program is accredited by the Commission on Accreditation of Allied Health Education Programs (www.caahep.org) upon the recommendation of the Joint th Review Committee on Education in Diagnostic Medical Sonography (JRC-DMS). CAAHEP is located at 9355 113 19

St. N, #7709, Seminole, FL 33775; phone: (727) 210-2350. This accreditation is for the San Jose and Sacramento Campusesonly. Associate of Occupational Science in Vascular Ultrasound Technology Program The Associate of Occupational Science in Vascular Ultrasound Technology Program is recognized by the American Registry of Radiologic Technologists® (ARRT®) – www.arrt.org/Education/Educational-Programs. Graduates from the programs, as mentioned above, are eligible to sit for ARRT® (VS). Anyone taking an examination offered by ARRT® and who graduates on or after January 1, 2015, must hold, at a minimum, an earned associate’s degree. For more information about ARRT®, please visit www.arrt.org. ARRT® is located at ARRT®,1255NorthlandDrive,St.Paul,MN55120,Phone:651-687-0048. The Associate of Occupational Science in Vascular Ultrasound Technology Program is accredited by the Commission on Accreditation of Allied Health Education Programs (www.caahep.org) upon the recommendation of the Joint Review Committee on Education in Diagnostic Medical Sonography (JRC-DMS). th CAAHEPislocatedat9355113 St.N,#7709,Seminole,FL33775;phone:(727)210-2350. Associate of Science in MRI Program The Associate of Science in MRI Technology Program is recognized by the American Registry of Radiologic Technologists® (ARRT®) – www.arrt.org/Education/Educational-Programs. Graduates from the programs, as mentioned above, are eligible to sit for the ARRT® (MRI). Anyone taking an examination offered by ARRT® and whograduates on or after January 1, 2015, must hold, at a minimum, an earned associate’s degree. For more information about ARRT®, please visit www.arrt.org. ARRT® is located at ARRT®, 1255 Northland Drive, St. Paul, MN55120,Phone:651-687-0048. Associate of Science in Nursing Program The Associate of Science in Nursing Program is approved by the California Board of Registered Nursing (BRN). Contact information for the California Board of Registered Nursing: 1747 N. Market Blvd., Suite 150, Sacramento,CA95834,Phone:(916)322-3350. Associate of Science in Physical Therapist Assistant Program The Associate of Science in Physical Therapist Assistant Program is accredited by the Commission on Accreditation in Physical Therapy Education (CAPTE), 3030 Potomac Ave., Suite 100, Alexandria, Virginia, 22305-3085; telephone: 703-706-3245; email [email protected]; website: http://www.capteonline.org. If you need to contact the program/institution directly, please call 650-425-9387 or email [email protected]. BachelorofScienceinNursingProgram The Bachelor of Science in Nursing Program is approved by the California Board of Registered Nursing (BRN). Contact information for California Board of Registered Nursing: 1747 N. Market Blvd., Suite 150, Sacramento, CA95834,Phone:(916)322-3350. DentalAssistant Program Gurnick AcademyofMedicalArtsisanapprovedcourseproviderbytheDentalBoardofCaliforniatoprovidean 8-hour Infection Control Certificate, a Coronal Polishing Certificate, and a Radiation Safety Certificate. Contact Information: the Dental Board of California is 2005 Evergreen Street, Suite 1550, Sacramento, CA 95815, (916) 263-2300. IV Therapy and Blood Withdrawal Course Gurnick Academy of Medical Arts is an approved course provider by the Board of Vocational Nursing and Psychiatric Technicians (BVNPT) to provide IV Therapy and Blood Withdrawal Certification Courses. 20

Vocational Nurse Program The Vocational Nurse Program is approved by the Board of Vocational Nursing and Psychiatric Technicians (BVNPT). The Board of Vocational Nursing and Psychiatric Technicians’ contact information is 2535 Capitol Oaks Drive, Suite 205, Sacramento, CA 95833, Phone: (916) 263-7800. X-ray Technician with Medical Assistant Skills Program The X-ray Technician with Medical Assistant Skills Program is approved by the California Department of Public Health, Radiologic Health Branch (CDPH-RHB) as a school for X-ray technicians. Contact Information for CDPH-RHBisP.O.Box997414,MS7610,Sacramento,CA95899-7414,(916)327-5106. State Authorization Gurnick Academy of Medical Arts offers distance education outside the state where the institution or program is physically located in California. All 50 states plus U.S. Territories regulate education on the state level. Gurnick Academy of Medical Arts makes every effort to follow each state’s regulations regarding offering distance education programs in compliance with all applicable laws, regulations, and accreditation standards. Students should research whether the Gurnick Academy of Medical Arts program meets their state’s professional requirements. A student’s physical location is identified at the time of application to determine program authorization requirements for enrollment in our programs. The basis for determining the student’s physical location is determined by official ID (a receipt of a Driver’s License or official U.S. identification) as required for admission (see General Admissions Requirements). If a student changes their physical location during the program, they shall notify Gurnick Academy of Medical Arts by completing a change of address form. Change of Address Forms are available on www.gurnick.edu or by asking a campus designee. Students must complete the Change of Address Form and bring the above-mentioned official documents in person to the Student Services Coordinator or Designated School Official located on their campus. Students can also mail notarized copies of documents with a cover letter explaining the change. Students who mail the certified documents must sign the cover letter, include their Gurnick Academy of Medical Arts student ID or social security number and date of birth, and send it to the student’s campus. Gurnick AcademyofMedicalArtshasnotdeterminedifanyprogramsfulfilltheeducationalrequirementsfor specific professional licensure or certification required for employment outside California unless identified by theprogrambelow.Itisrecommendedthatstudentswhoarelocatedinorplantorelocatetoastateapart fromthephysicalcampusofferingtheprogramresearchanycertificationoremploymentrequirementsfortheir intendedstate. Gurnick AcademyofMedicalArtscanenrollstudentsindistanceeducationinthestatesbelow,adheringto eachstate’s requirements: ● Arizona: The academy has identified non-regulation from licensure due to the absence of physical presence from the Arizona State Board for Private Postsecondary Education for the Associate of Science in MRI program. ● Nevada:TheacademyhasobtainedapprovalfromtheNevadaCommissiononPostsecondaryEducation to offer the Associate of Science in MRI program. ● Florida: The academy has been notified of non-regulation from licensure due to a lack of physical presence from the Florida Commission for Independent Education for the Associate of Science in MRI program. OtherApprovalsandMemberships ● The US Department of Education approves Gurnick Academy of Medical Arts to participate in Title IV/Federal Financial Aid programs. 21

● Gurnick Academy of Medical Arts is a California Association of Private Postsecondary Schools (CAPPS) member. ● GurnickAcademyofMedicalArtsisapprovedtoacceptparticipantsfromtheWorkforceInvestmentAct (WIA), EmploymentDevelopmentDepartment(EDD),andCaliforniacounties’retrainingprograms. ● Gurnick Academy of Medical Arts, San Jose campus, is approved by the Student and Exchange Visitor Program (SEVIS) to accept international students. More information can be found at egov.ice.gov/sevis/. ● GurnickAcademyofMedicalArtsisaChamberofCommerce(SMCC)member. ● The National Healthcare Association approves Gurnick Academy of Medical Arts to administer the Certified EKG Technician and Certified Phlebotomy Technician examinations. Individuals who want to review the accrediting/licensure documentation should contact the Campus Director. ADMISSIONPOLICIES PREREQUISITES,COREQUISITES,&ADMISSIONCOURSES Gurnick Academy of Medical Arts has established program prerequisites and course corequisites appropriately onaprogrammaticandcourse-by-coursebasis. Prerequisites are courses that must be completed before starting the core programs. Passing prerequisites demonstrates the competency of knowledge necessary for beginning the core program. Prerequisite Challenge Examsareavailableforthosewhoareinterested. Courses such as the LVN-to-RN Transition Course must be completed to meet the eligibility requirements for admission into their respective programs. Completing these courses does not guarantee automatic enrollment into their respective programs. Please review individual program admission requirements for more details. Students taking prerequisites or admission courses such as Essential Medical Biosciences or Nursing Transition for Advanced Placement are limited to two (2) attempts. Students may request one (1) additional attempt every 12 months from thefinal attempt, with approval by the Program Director. Students requesting further attempts must submit a written request to the Program Director, outlining what they will do to succeed during this attempt. Corequisites are defined as courses that must be taken simultaneously. However, a failure in one course does not meanfailureintheco-requisitecourse.Onlythefailedcourseneedstoberepeated. Paired courses must be taken simultaneously. A failure in one of the paired courses means failure in all paired courses. Each of the paired courses will need to be retaken. Kindly note that prerequisite courses do not fall within the ABHES scope of accreditation, nor do we award academiccreditsforthosecourses.Prerequisite and admission courses are also not eligible for Financial Aid. Gurnick AcademyofMedicalArtsprovidesonline,residential,hybrid, prerequisite, and admission courses. REGISTRATIONFEE All new applicants are subject to pay the $100.00 Registration Fee. 22

Individuals who were enrolled but never started a core program and wish to enroll again are considered new applicants after 270 days (9 months) from the initial start date and must pay the Registration Fee again. Gurnick Academy of MedicalArtsgraduateswhodesiretoenrollagainareconsiderednewapplicantsandmustalsopay theRegistration Fee. Individuals eligible to re-enroll are subject to pay the Registration Fee if re-enrollment occurs after 180 days of anapprovedwithdrawal/expulsion/completiondate. Those eligible to re-enroll are not subject to paying the $100.00 Registration Fee if re-enrollment occurs within 180daysofanapprovedwithdrawal/expulsion/completiondate. Individuals who want to transfer from one cohort group to a different program or time frame are not subject to paying the Registration Fee. INTERNATIONALSTUDENTADMISSIONS International applicants are encouraged to apply for admission. All applicants must meet the exact requirements as U.S. citizens as outlined above. An English evaluation should accompany all documents. Students whose native language is not English will be required to take the English as Foreign Language (TOEFL) or equivalent. The following minimum TOEFL scores must be obtained: 45 for the iBT (internet-based test) or demonstrate English proficiency through other measures established by Gurnick AcademyofMedicalArts. Requirements for proof of English Language Proficiency through TOEFL or International English Language System(IELTS): ● IndividualswhohavegraduatedfromaU.S.highschoolandhavepassedCAproficiencywillbeexempt fromtakingtheTOEFL. ● IndividualswhohavegraduatedfromaU.S.college/universitywithanAS/AAorhigherwillbeexempt fromtakingtheTOEFL. ● IndividualswhohavegraduatedfromanEnglish-speakingcountry,suchasCanada,Nigeria,ortheUK, will be exempt from taking the TOEFL. ● ForthoseoptingforIELTS,aminimumscoreof6.5isrequiredineachsection,withanoverallband score of 6.5 or higher. An affidavit of financial support is recommended to be submitted but is not required. More detailed information will be provided through our Admissions office. Gurnick Academy of Medical Arts is authorized to enroll non-immigrant students under federal law. Besides F1 and M1 visas, Gurnick Academy of Medical Arts does not offer visa services. If requested, Gurnick Academy of Medical Arts will document and vouch for the current student status. ABILITY TO BENEFIT Gurnick AcademyofMedicalArtsdoesnotacceptAbility-to-Benefit(ATB)students. ADMISSIONREQUIREMENTS The table below is only a summary of Admission Requirements. A complete list of admission requirements is presented in the General Admission Requirements for all programs, as well as Additional Admission Requirementsperprogram. 23

Table 2. Admission Requirements Summary Minimum Minimum Admission Entrance Prerequisite OtherGeneral Programmatic Program Degree Point Exam Courses Requirements Requirements Requirement System Score Yes, some Info Session, CCAT VN campuses Interview 16 Yes* only (if applicable) MA Info Session, CCAT ● Beatleast18 No Essay, Interview 14 DA years of (if applicable). age.** A.O.S. in CCAT RT 25 ● Meetwiththe Info Session, Admissions Interview A.S. in NM CCAT Advisor and (if applicable) Financial Aid HSD/GED Advisor (if A.O.S. in applicable). UT Info Session, A&P A.O.S. in No Test, Interview UCAT ● Payall CUT (if applicable). applicable A.O.S. in fees. VUT Info Session, A.S. in CCAT ● Immunization, Interview Yes MRI 18 Health (if applicable). Screening, Info Session, Essay, Background A&PTest, Check, Drug A.S. in RT CCAT Interview Testing, and (if applicable). CPR. HSD/GED(plus Info Session, ● Program’s college CCAT Observation A.S. in PTA No performance Hours, Essay, A&P coursework) requirements. Test, Interview. Basedon ● Studentskills, ADN& See the Info Session, HSD/GED hardware, LVNtoRN TEAS admission Interview. andsoftware pathway requirements HSD/GEDplus (for distance proof of education graduation from courses). a A.S. in VN N/A No No N/A Board-approved Vocational Nursing Program(min. 24

2.5 GPA) or completing 1,530VN programclock hours(BVNPT approved curriculum). Info Session, A.O.S. in TEAS> HSD/GED Yes No Essay, Interview, if RC 64% applicable. 70Semester credits (Previous core HSD/GEDplus coursework two(2)Year andregistry Equivalent B.S. in =54 Imaging N/A No N/A DMI Semester education and Credits and ARRT®registry 16Semester or equivalent. Credits for General Education courses). See BSN,LVNto HSD/GEDplus TEAS BSN,RNto RNlicense (for BSN Yes Yes BSN Info Session, andLVN Essay, Letters of to BSN) Recommendation, Verification of Health-related Work,Interview(if BSN(min.3.0 applicable). BSNto GPA)plusRN N/A Yes No MSN license Info Session, Essay, Letters of Recommendation, B.S. in RT HSD/GED CCAT Yes No 40hoursof 25 observation, Interview. DXA Info Session, CCAT HSD/GED Yes No Essay, Interview 18 XTMAS (if applicable). *Prerequisite courses may be taken at Gurnick Academy of Medical Arts. **SeeAdditionalAdmissionRequirementsperprogramforminimumagerequirements. 25

Per the Gurnick Academy of Medical Arts Employee Manual, the Executive Corporate Management Teammay accept a maximum of one (1) nominated applicant per program start who meets all admissions requirements withoutapointrankingsystem,ifapplicabletotheprogramofinterest. GeneralAdmissionRequirementsforallPrograms All applicants to Gurnick Academy of Medical Arts must: 1. Meet with the program’s Admission Advisor to review all required disclosures and receive complete information before enrolling with Gurnick Academy of Medical Arts. Kindly note that some programs may have additional requirements, such as attending a live or viewing a recording of an Information Session before meeting with Admissions; please see Additional Admissions Requirements per program. 2. Meet with a Financial Aid Advisor to review all required disclosures and receive complete information before enrolling at Gurnick Academy of Medical Arts. This requirement does not apply to non-financial aid programs or courses. 3. Pay all applicable fees per the published fee schedule before issuing an enrollment agreement or makingotherpaymentarrangementsacceptabletoGurnickAcademyofMedicalArts. 4. Possess a High School Diploma from an approved/accredited high school or a GED. Please ask an Admission Advisor for more details and the approved high school list. Please refer to the Foreign Transcript/Diploma Evaluation Policy for more information regarding additional requirements. 5. At least 18 (official ID is required) to enroll in a core program. Some programs may allow enrollment at age 17. Please see program-specific admission requirements for details. 6. Complete the entrance exam with the minimum score required as outlined in the table Admission Requirements Summary. All Programs utilize the Criteria Cognitive Aptitude Test (CCAT) with a minimumentranceexamscoreunlessspecifiedinthetableabove. 7. CompletetheOnlineApplicationconsistingofthefollowingdocuments: a. Online Application b. NewStudentQuestionnaire c. Distance Education Questionnaire d. AcademicIntegrity Statement e. ConsenttoReceiveElectronicCommunications 8. Comply with all Gurnick Academy of Medical Arts requirements for Immunizations, Health Screening, Background Check, and CPR/First Aid policy. 9. Complywiththeprogram’sperformancerequirements. Readeachprogram’sperformancerequirementsintheProgramPerformanceRequirementssection. 10. ComplywiththeAdditionalAdmissionRequirementsperprogram. Please review this section for the applicable program. 11. Meet the minimum student skills, hardware, and software requirements if the student enrolls in distance education (online) courses. Please refer to the Minimum Requirements for Students Enrolling in the Distance Education Courses section. 12. Ability to read and write English at an American high school graduate level, as demonstrated by a high school diploma, GED, or passing the California high school proficiency exam. Criteria Cognitive Aptitude Test (CCAT) The Criteria Cognitive Aptitude Test (CCAT) is an aptitude test that measures an individual’s aptitude to solve problems, digest and apply information, learn new skills, and think critically. The exam consists of 50 items. There is no cost for this exam. Applicants are allowed three (3) attempts within a calendar year to pass the exam.Studentsareallowedtoretestthesamedayasthefirstfailedexam.Theremustbeatleastseven(7)days betweenattemptsafterthat. 26

Results are valid for one (1) year. Please note that if a graduate (or current student) applies for another program and their CCAT result has expired, this person must retake the test. Students applying to a program without a minimumrequiredscorewillhaveoneopportunitytotakethetestwithinacalendaryear. Universal Cognitive Aptitude Test (UCAT) The Universal Cognitive Aptitude Test (UCAT) is an aptitude test that measures an individual’s aptitude to solve problems, digest and apply information, learn new skills, and think critically. The exam consists of 40 items with a 20-minute time limit. Applicants are allowed two (2) attempts within a calendar year to take the exam. There mustbeatleastseven(7)daysbetweenattempts. Test of Essential Academic Skills (TEAS®) The Test of Essential Academic Skills (TEAS®) measures essential basic skills in the academic content domains of reading, mathematics, science, and English and language usage. The test is intended for use primarily with adult nursing program applicant populations. The objectives assessed on TEAS® VII* are those that nurse educators deemed most appropriate and relevant to measure the entry-level academic readiness of nursing program applicants. The TEAS exam is proctored remotely by ATI, and the cost for this exam is $115 per individual test taker. Applicants are allowed two (2) attempts a year starting from the first exam’s original date. Results are valid only for one year. All students are encouraged to log on to www.atitesting.com for study material and other useful resources and information. For the A.S. in Nursing and B.S. in Nursing programs, the score on the most recent attempt will be accepted for theA.S. in Nursing and B.S. in Nursing. Breakdownoftestsubjects(bythepercentageoftheentiretest): o Reading–28% o Mathematics–20% o Science–32% o EnglishandLanguageUsage–20% Additional Admission RequirementsperProgram Associate of Occupational Science in Cardiac Ultrasound Technology Program (A.O.S. in CUT) Applicants must: 1. AttendorviewaliveorrecordedInformationSession. 2. Submit original transcripts from the Registrar at an educational Institution for applicants requesting credit granting for some/all General Education courses. Copies are not accepted. All coursework must be completed and given a grade of at least a “C.” Anatomy and Physiology I with Laboratory must be completed within the last five (5) years. All credit granting is subject to the approval of the ProgramDirectororProgramCoordinator.Pleaseallowseven(7)daysforreview. 3. CompleteanadmissioninterviewwiththeProgramDirectoranddesignees. Associate of Occupational Science in CUT Admission Point System Applicants are deemed qualified on a point system. The highest-ranked (above a minimum) will be offered seats in the program. The following point system evaluates each applicant, showing the maximum score achievable. Table 3. A.O.S. in CUT Admission Point System 27

I. Admissions Exam Possible Points 25 ● Anatomy&PhysiologyAssessmentTest(100-85) 20 ● Anatomy&PhysiologyAssessmentTest(84-80) 15 ● Anatomy&PhysiologyAssessmentTest(79-69) 10 ● Anatomy&PhysiologyAssessmentTest(68-50) 5 ● Anatomy&PhysiologyAssessmentTest(49andlower) UCAT ● 35orgreater 35 25 ● 30-34 15 ● 25-29 0 ● 24orless II. Post-Secondary Education 10 ● AssociateDegree 20 ● BaccalaureateDegree 30 ● Graduate/Master’sDegree 45 ● Post-Graduate/DoctoralDegree III. Academic Achievement: College level Courses & High school AP courses A. Overall GPA 5 ● GPA3.0 10 ● GPA3.5 15 ● GPA3.9 B. MathandScienceGPA 20 ● GPA3.0 30 ● GPA3.5 40 ● GPA3.9 IV. One-Page Resume(required) 30 V. Health Care Background 10 ● Onetothree(1–3)years 25 ● Morethanthree(3)years VI. Reapplication (having completed reapplication requirements) 15 VII. Personal Interview 150 ● InterviewQuestions ● Maturity 28

● CommunicationSkills ● AppearanceandDemeanor VIII. Evaluation from the Office of Admissions 50 Possible Total Points: 430 Associate of Occupational Science in Respiratory Care Program (A.O.S. in RC) Applicants must: 1. Attend or view a live or recorded Information Session. 2. Meet the following admission policies of Gurnick Academy of Medical Arts: immunization, health screening, and background check (see Policies of Gurnick Academy of Medical Arts in School Catalog and“Admissions”). 3. Submit original transcripts from the Registrar at an educational institution for those requesting credit granting for courses. Copies of transcripts are not accepted. All coursework must be completed with a grade of at least a “C” and a cumulative grade point average (GPA) of 2.5 (on a 4-point) scale. All credit granting is subject to the Program Director or designee’s approval. Please allow seven (7) days for review. 4. Take an Admission Assessment test: the Test of Essentials Academic Skills (TEAS), testing math, reading, English language use, and science. All students are encouraged to log on to www.atitesting.com for study material and other useful resources and information. The TEAS VII Test Passing score = 64% or higher. 5. Pass an interview with the Program Director or Designee in person or online. 6. Submit a written essay on why they have chosen this career path. 7. Before starting this career choice, if an applicant has a criminal record and has been convicted of a felony, it would be in their best interest to contact the Respiratory Care Board (RCB) BEFORE they continue their education endeavors. “Having a prior criminal history does not preclude you from obtaining a license from the Respiratory Care Board of California (RCB). Each applicant for licensure must submit their fingerprints to the California Department of Justice and Federal Bureau of Investigation for a criminal history background check. Upon notification of an applicant’s criminal history, if any, the RCB will open an investigation to determine whether there is a basis to deny the application for licensure.” Table 4. A.O.S. In RC Admission Point System Criteria Possible Points I. Admissions Exam 40 ● TEAS(90.00–100.00) 40 ● TEAS(80.0–89.99) 30 ● TEAS(70.0–79.99) 20 ● TEAS(64.0–69.99) 10 Gurnick AcademyofMedicalArtsusestheTestofEssentialAcademicSkills.The minimumcompositescoreis64%foradmissiontotheAssociateofOccupational Science in Respiratory Care Program. The program will only accept a maximum of two(2)attemptsinoneyear,withthefirstpassingscoreof64%.Ifstudentsdo notattain the minimumof64%onthefirstattempt,theymayretestwithinone (1) year. II. Post-Secondary Education 20 ● Associate Degree 5 ● Baccalaureate Degree 10 ● Graduate/Master’s Degree 20 29

III. Academic Achievement: College level Courses & High school AP courses 30 A. GPAinNon-BiologyPrerequisiteCourses:Reading&Composition,Psychology, Public Speaking, Sociology, Critical Thinking, Nutrition ● GPA2.50-2.59 2 ● GPA2.60-3.00 5 ● GPA3.01-3.59 10 ● GPA3.6-4.0 15 B. GPA in Math and Sciences: Intermediate Algebra, Anatomy & Physiology, Microbiology ● GPA2.50-2.59 2 ● GPA2.60-3.00 5 ● GPA3.01-3.59 10 ● GPA3.6-4.0 15 IV. Health Care Background 5 ● Onetothree(1–3)years 3 ● Morethanthree(3)years 5 V. Personal Interview 20 ● Professionalism 4 ● AppearanceandDemeanor 4 ● CommunicationSkills 4 ● AnsweringSkills 4 ● Overall Impression 4 VI. Evaluation from the Office of Admissions 5 ● Professionalism 1 ● Timeliness 1 ● Communication ● Compliancewiththerequirements 1 ● Self-Motivation 1 Total Possible Points for Criterion I through Criterion VI: 120 Points Associate of Occupational Science in Radiologic Technology Program (A.O.S. in RT) Applicants must: 1. AttendorviewaliveorrecordedInformationSession. 2. For applicants requesting credit granting for some/all General Education courses – original transcripts from the Registrar at an educational institution. Copies of transcripts are not accepted. All coursework must be completed with a grade of at least a “C.” All credit granting is subject to the ProgramDirectorordesignee’sapproval.Pleaseallowseven(7)daysforreview. 3. PassanESLtestiftheapplicantisanon-nativeEnglishspeaker. 4. Submit two (2)letters of reference. The letters must be typed, dated, and signed within the past two (2) years. The references can be from a current supervisor, employer, and science or math teacher of apost-secondaryinstitution. 5. Submitaone-pageessayinAPAformatthatincludesthefollowing: a. Statementofwhyyouwouldliketojointhemodality. b. Theessential functions and role of a Technologist in this field. 30

c. Preparation to become successful in this program. d. Sources used to prepare for the essay. 6. PassanadmissioninterviewwiththeProgramDirectoranddesignees. 7. Applicants whopossessacurrentStateofCaliforniaLimitedPermit(License)inChest,Extremities, andTorsoSkeletalwill receive credit granting for a portion of the program. 8. GurnickAcademyofMedicalArtsXTMASprogramgraduateswhohavetakenthestateexamandare awaiting the results can enroll as provisional students into the A.O.S. in RT program. If the graduate fails to earn a license in all three categories listed above, the student will be dropped from the A.O.S. in RT program for failing to meet all the admission requirements. A.O.S. in RT Admission Point System Applicants are deemed qualified on a point system. The highest-ranked (above a minimum) may be offered seats in the program. The following point system evaluates each applicant, showing the maximum achievable score. Table 5. A.O.S. in RT Admission Point System I. Admissions Exam Possible Points 50 ● CCAT II. Post-Secondary Education 10 ● AssociateDegree 20 ● BaccalaureateDegree 30 ● Graduate/Master’sDegree 40 ● Post-Graduate/DoctoralDegree III. Academic Achievement: College level Courses & High school AP courses A. Overall GPA 5 ● GPA3.0 10 ● GPA3.5 15 ● GPA3.9 B. MathandScienceGPA 20 ● GPA3.0 30 ● GPA3.5 35 ● GPA3.9 IV. One-Page Resume(required) 25 V. Essay – One-page, APA Format 25 Theessaywillinclude: - Statementofwhyyouwouldliketojointhismodality. - Theessential functions and role of a technologist in this field. - Preparation to become successful in this program. - Sources used to prepare for the essay. 31

VI. Health Care Background 10 ● Onetothree(1–3)years 20 ● Morethanthree(3)years VII. Reapplication (having completed reapplication requirements) 20 VIII. Personal Interview 120 - Five (5) Interview Questions - AppearanceandDemeanor - CommunicationSkills - Maturity - Overall Impression IV. Evaluation from the Office of Admissions 50 Possible Total Points: 400 Associate of Occupational Science in Ultrasound Technology Program (A.O.S. in UT) Applicants must: 1. AttendorviewaliveorrecordedInformationSession. 2. Submit original transcripts from the Registrar at an educational institution for applicants requesting credit granting for some/all General Education courses. Copies are not accepted. All coursework must be completed and given a grade of at least a “C.” Anatomy and Physiology I with Laboratory must be completed within the last five (5) years. All credit granting is subject to the approval of the ProgramDirectororProgramCoordinator.Pleaseallowseven(7)daysforreview. 3. CompleteanadmissioninterviewwiththeProgramDirectoranddesignees. Associate of Occupational Science in UT Admission Point System Applicants are deemed qualified on a point system. The highest-ranked (above a minimum) will be offered seats in the program. The top-scoring candidates will be brought in for the interview process. The following point systemevaluateseachapplicant,showingthemaximumscoreachievable. Table 6. A.O.S. in UT Admission Point System I. Admissions Exam Possible Points 25 ● Anatomy&PhysiologyAssessmentTest(100-85) 20 ● Anatomy&PhysiologyAssessmentTest(84-80) 15 ● Anatomy&PhysiologyAssessmentTest(79-69) 10 ● Anatomy&PhysiologyAssessmentTest(68-50) 5 ● Anatomy&PhysiologyAssessmentTest(49andlower) UCAT ● 35orgreater 35 25 ● 30-34 15 ● 25-29 0 ● 24orless II. Post-Secondary Education 10 ● AssociateDegree 20 ● BaccalaureateDegree 30 ● Graduate/Master’sDegree 32

45 ● Post-Graduate/DoctoralDegree III. Academic Achievement: College level Courses & High school AP courses A. Overall GPA 5 ● GPA3.0 10 ● GPA3.5 15 ● GPA3.9 B. MathandScienceGPA 20 ● GPA3.0 30 ● GPA3.5 40 ● GPA3.9 IV. One-Page Resume(required) 30 V. Health Care Background 10 ● Onetothree(1–3)years 25 ● Morethanthree(3)years VI. Reapplication (having completed reapplication requirements) 15 VII. Personal Interview 150 ● InterviewQuestions ● Maturity ● CommunicationSkills ● AppearanceandDemeanor VII. Evaluation from the Office of Admissions 50 Possible Total Points: 430 Associate of Occupational Science in Vascular Ultrasound Technology Program (A.O.S. in VUT) Applicants must: 1. AttendorviewaliveorrecordedInformationSession. 2. Submit original transcripts from the Registrar at an educational institution for applicants requesting credit granting for some/all granting for some/all General Education courses. Copies are not accepted. All coursework must be completed and given a grade of at least a “C.” Anatomy and Physiology I with Laboratory must be completed within the last five (5) years. All credit granting is subject to the approval of the Program Director or Program Coordinator. Please allow seven (7) days for review. 3. CompleteanadmissioninterviewwiththeProgramDirectoranddesignees. Associate of Occupational Science in VUT Admission Point System Applicants are deemed qualified on a point system. The highest-ranked (above a minimum) will be offered seats in the program. The following point system evaluates each applicant, showing the maximum score achievable. Table 7. A.O.S. in VUT Admission Point System I. Admissions Exam Possible Points 25 ● Anatomy&PhysiologyAssessmentTest(100-85) 20 ● Anatomy&PhysiologyAssessmentTest(84-80) 15 ● Anatomy&PhysiologyAssessmentTest(79-69) 10 33

5 ● Anatomy&PhysiologyAssessmentTest(68-50) ● Anatomy&PhysiologyAssessmentTest(49andlower) UCAT ● 35orgreater 35 25 ● 30-34 15 ● 25-29 0 ● 24orless II. Post-Secondary Education 10 ● AssociateDegree 20 ● BaccalaureateDegree 30 ● Graduate/Master’sDegree 45 ● Post-Graduate/DoctoralDegree III. Academic Achievement: College level Courses & High school AP courses A. Overall GPA 5 ● GPA3.0 10 ● GPA3.5 15 ● GPA3.9 B. MathandScienceGPA 20 ● GPA3.0 30 ● GPA3.5 40 ● GPA3.9 IV. One-Page Resume(required) 30 V. Health Care Background 10 ● Onetothree(1–3)years 25 ● Morethanthree(3)years VI. Reapplication (having completed reapplication requirements) 15 VII. Personal Interview 150 ● InterviewQuestions ● Maturity ● CommunicationSkills ● AppearanceandDemeanor VIII. Evaluation from the Office of Admissions 50 Possible Total Points: 430 Associate of Science in Magnetic Resonance Imaging Program (A.S. in MRI) Applicants must: 1. AttendorviewaliveorrecordedInformationSession. 2. Submit original transcripts from the Registrar at an educational institution for applicants requesting credit granting for General Education Courses. Copies are not accepted. All coursework must be completed and given a g rade of at least a “C.” Anatomy and Physiology I with Laboratory must be 34

completed within the last five (5) years. All credit granting is subject to approval from the Program Director or Program Coordinator. Please allow seven (7) days for review. Associate of Science in MRI Admission Point System Applicants are deemed qualified on a point system. The highest-ranked applicants (above a minimum) may be offered seats in the program. The following point system evaluates each applicant, showing the maximumachievablescore. Table 8. A.S. in MRI Admission Point System I. Admissions Exam Possible Points 50 ● CCAT II. Basic Anatomy Assessment Test 30 30 ● 90-100 20 ● 80-89 10 ● 70-79 5 ● 60-69 0 ● 0-59 III. Post-Secondary Education 40 10 ● AssociateDegree 20 ● BaccalaureateDegree 30 ● Graduate/Master’sDegree 40 ● Post-Graduate/DoctoralDegree IV. Academic Achievement: College level Courses 44 A=9pts ● Anatomy B=5pts ● Physiology C=2pts ● CollegeAlgebra A=2pts ● MedicalTerminology B=1.5pts ● Critical Thinking C=1pts ● Biology ● Sociology V. AcademicAchievement:CollegelevelGPA 20 Overall GPA 5 ● GPA3.0 10 ● GPA3.5 20 ● GPA3.9 VI. One-Page Resume(required) 20 VII. Health Care Background 20 10 ● Onetothree(1–3)years 35

20 ● Morethanthree(3)years VIII. Clinical Affiliate Employee 15 IX. Evaluation from the Office of Admissions 50 Topapplicants will be invited to a personal interview. Top interviewed applicants will be selected for programadmission. X. Personal Interview 120 - Five (5) Interview Questions - AppearanceandDemeanor - CommunicationSkills - Maturity Overall Impression Possible Total Points: 409 Associate of Science in Nuclear Medicine Technology Program (A.S. in NM) Applicants must: 1. AttendorviewaliveorrecordedInformationSession. 2. Submit original transcripts from the Registrar at an educational institution for applicants requesting credit granting for some/all General Education Courses. Copies are not accepted. All coursework must be completed with agradeofatleasta“C.”Allcreditgrantingissubjecttotheapprovalofthe ProgramDirectororProgramCoordinator.Pleaseallowseven(7)daysforreview. Associate of Science in NM Admission Point System Applicants are deemed qualified on a point system. The highest-ranked (above a minimum) will be offered seats in the program. The top-scoring candidates will be brought in for the interview process. The following point system evaluates each applicant, showing the maximum score achievable. Table 9. A.S. in NM Admission Point System Points Category: Possible Points I. CCAT 50 II. Post-Secondary Education 50 25 ● AssociateDegree 50 ● BaccalaureateDegreeorhigher III. Academic Achievement: College level GPA 160 30 ● AnatomywithLaboratory 30 ● PhysiologywithLaboratory 30 ● CollegeAlgebra 30 ● Physics 10 ● English 30 ● ChemistrywithLaboratory 36

If the course was taken more than twice (to include drop/withdrawal), it would not be counted in points. The AnatomyandPhysiologycoursesmustbe(2)twoseparatecourses,eachwithalaboratory. IV. One-Page Resume(required) 10 V. Health Care Background 80 20 ● Onetothree(1–3)years 30 ● Morethanthree(3)years 50 ● BackgroundasaregisteredRT,Sonographer,MRItechnologist, or Radiation Therapy Technologist. VI. Personal Interview 50 ● InterviewQuestions ● AppearanceandDemeanor ● CommunicationSkills ● Maturity ● OverallImpression ● HolisticEvaluation VII. Evaluation from the Office of Admissions 25 Possible Total Points: 425 Associate of Science in Nursing Program (ADN) ADNGenericPathway 1. AttendorviewaliveorrecordedInformationSession. 2. Applicants must meet the following admission policies of Gurnick Academy of Medical Arts: immunization, health screening, background check, and CPR certification (See Policies of Gurnick AcademyofMedicalArtsintheSchoolCatalogand“Admissions”). 3. Applicants must submit a completed application. It is recommended that interested applicants fill outtheapplicationwiththeadmissionadvisor. 4. Applicants must take an Admission Assessment: The Test of Essential Academic Skills (TEAS VII). It tests math, reading, English and language use, and science. All students are encouraged to log on to atitesting.com for study material and other valuable resources and information. The TEAS VII Test Passing score = 64% or better. 5. Applicants will be asked to pass an interview with the Nursing Program Director, Assistant Program Director, or designee in person or via a virtual conferencing platform, if necessary. 6. Applicants must have a cumulative grade point average (GPA) of 2.5 (on a 4-point scale) or higher in non-biology prerequisite coursework. Official transcripts are required. 7. Applicants must have a cumulative grade point average (GPA) of 2.5 (on a 4-point scale) or higher in mathandscienceprerequisitecoursework.Officialtranscripts are required. 8. Applicants must submit a two- to three-page (2 – 3) written essay on why they have chosen professional nursing as a career. 9. Applicants must submit three (3) letters of recommendation to the nursing program. These may come from employers, immediateworksupervisors,health-relatedfacilities where the applicant has volunteered, or faculty from previous college/university coursework. These letters of recommendationmustbesubmittedonformalorganizationalstationery. 10. The applicant will submit proof of health-related &/or community work, e.g., volunteering at health fairs, hospitals, or clinics, working with the homeless, mentoring or tutoring other students, Big Brother or Big Sister. These experiences must be substantiated with a document or letter of 37

verification on formal organizational stationery. 11. Applicants will be rank-ordered based on the following score, which includes: ● AdmissionAssessmentTest(TEAS) ● PersonalInterview ● WrittenEssay ● ThreeLettersofRecommendation ● CommunityWork ● Health-RelatedExperience ● LVN-RNAP o Applicants must meet the followingadmissionpolicies of Gurnick Academy of Medical Arts: immunization, health screening, background check, and CPR certification (See Policies of Gurnick AcademyofMedicalArtsintheSchoolCatalogand“Admissions”). o Applicants must submit a completed application. It is recommended that interested applicants fill out the application with the admission advisor. o Applicants must take an Admission Assessment: The Test of Essential Academic Skills (TEAS VII). It tests math, reading, English and language use, and science. All students are encouraged to log on to atitesting.com for study material and other valuable resources and information. The TEAS VII Test Passing score = 64% or better. o If necessary, applicants will be asked to pass an interview with the Nursing Program Director or Associate Program Director in person or via a virtual conferencing platform. o Applicants must submit a two to three-page (2 – 3) written essay on why they have chosen professional nursing as a career. o Applicantsmustsubmitproofofone(1)yearoffull-timeLVN/LPNworkexperiencewithinthe last three years or be a recent graduate of an LVN/LPN school (within one year at the time of application) or have completed an LPN/LVN Refresher/Re-entry program within one (1) year of admission. o Applicants must submit transcripts showing proof of completing the 33 units of General Education courses that comprise Semesters I and II of the ADN Generic Pathway. o Applicantsmustsubmitaresume. o Applicants must have a cumulative grade point average (GPA) of 2.5 (on a 4-point scale) or higher in non-biology prerequisite coursework. Official transcripts are required. o Applicants must have a cumulative grade point average (GPA) of 2.5 (on a 4-point scale) or higher in math and science coursework. Official transcripts are required. ● LVN30-UnitOption o ProofofcurrentCaliforniaVocationalNurselicense. o TheProgramDirectororAssistantProgramDirectorwillprovidecounselandevaluation. o Anofficialtranscript must be submitted to the Office of Admissions. o CompleteMicrobiologywithlabforfour(4)units,withaGPAof2.5foreachcourse. o Complete any stand-alonePhysiologywithLabthatincludesallbodysystemsorequivalentto AnatomyandPhysiologywithLabs. o Applicants must meet the following admission policies of Gurnick Academy of Medical Arts: immunization, health screening, background check, and CPR certification (see Policies of Gurnick AcademyofMedicalArtsintheSchoolCatalogand“Admissions”). o Applicants must have a cumulative grade point average (GPA) of 2.5 (on a 4-point scale) or higher in all college coursework. Official transcripts are required. o Applicants must take the Test of Essentials Academic Skills. It tests math, reading, English and language use, and science. All students are encouraged to log on to www.atitesting.com for study material and other useful resources and information. The TEAS Test Passing score = 64%orbetter. 38

o If necessary, Applicants will be asked to pass an interview with the Nursing Program Director or Associate Program Director in person or via a virtual conferencing platform. o Applicants must submit a two to three-page (2 – 3) written essay on why they have chosen professional nursing as a career. Credit Granting for Nursing Education Students may request credit granting for previously taken nursing courses. If official transcripts are not submitted at the time of the application, the student forfeits the opportunity to apply for credit granting on previous courses. LVNs can transfer 22 Semester Credit Hours of LVN courses taken at the post-secondary level at an institution accredited by an agency recognized by the United States Department of Education or the Council of Higher Education Accreditation. Thecontentofthese22transfercreditsshallincludethefollowing: ● Nursing Theory hours (before the program): 13 semester credit hours for the following equivalent courses at Gurnick Academy of Medical Arts: - RN100FundamentalsofNursing(3semestercredithours) - RN102HealthAssessmentTheory(2semestercredithours) - RN104FundamentalsofPharmacology(2semestercredithours) - RN200 Medical-Surgical Nursing I Theory-Intro to Med-Surg (3 semester credit hours) - RN202 Medical-Surgical Nursing II Theory-Intermediate Med-Surg (3 semester credit hours) ● NursingLabhours(before theprogram):1.5semestercredithoursfor: - RN103HealthAssessmentSkillsLab(1.5semestercredithours) ● NursingClinicalhours(beforethe program):7.5semestercredithoursfor: - RN101FundamentalsofNursingClinicalandLab(3.5semestercredithours) - RN201Medical-SurgicalNursingIClinical(2semestercredithours) - RN203Medical-SurgicalNursingIIClinical (2 semester credit hours) Table 10. ADN General Education Hours PREREQUISITE SEMESTERCREDITHOURS HumanBodyinHealthandDiseaseIwithLab 4.0 GeneralMicrobiologywithLab 4.0 English Reading and Composition 3.0 Algebra I 3.0 GeneralPsychology 3.0 HumanBodyinHealthandDiseaseIIwithLab 4.0 Nutrition in Health & Disease 3.0 Critical Thinking 3.0 Introduction to Sociology 3.0 Public Speaking, Basics of Effective Communication 3.0 TOTALGURNICKACADEMYGENERALEDUCATIONCOURSES 33.0 39

All prerequisite courses must meet the baseline general education criteria for the California State University system(CSUs). Please note: A transcript MUST be provided for the above prerequisites if credit granting and will only be acceptedfromanaccreditedinstitutionapprovedbytheU.S.DepartmentofEducation. The minimum composite score is 64% for Associate Degree Nursing Program admission. The program will only accept a maximum of two (2) attempts in one (1) year, with the first passing score of 64%. If students do not attain the minimum of 64% on the first attempt, they may retest within one (1) year. Gurnick Academy of Medical Arts uses the Test of Essential Academic Skills. The minimum composite score is 64% for Associate Degree Nursing Program admission. The program will only accept a maximum of two (2) attempts in one (1) year, with the first passing score of 64%. If students do not attain the minimum of 64% on the first attempt, they may retest within one (1) year. Table 11. ADN Admission Point System Criteria Possible Points I. Admissions Exam 40 ● TEAS(90.00–100.00) 40 ● TEAS(80.0–89.99) 30 ● TEAS(70.0–79.99) 20 ● TEAS(64.0–69.99) 10 Gurnick AcademyofMedicalArtsusestheTestofEssentialAcademicSkills.The minimumcompositescoreis64%forAssociateDegreeNursingProgramadmission.The programwillonlyacceptamaximumoftwo(2)attemptsinoneyear,withthefirst passing score of 64%. If students do not attain the minimum of 64% on the first attempt, they may retest within one (1) year. II. Post-Secondary Education 20 ● AssociateDegree 5 ● BaccalaureateDegree 10 ● Graduate/Master’sDegree 20 III. Academic Achievement: College level Courses & High school AP courses 30 A. GPAinNon-BiologyPrerequisiteCourses:Reading&Composition,Psychology,Public Speaking, Sociology, Critical Thinking, Nutrition ● GPA2.50-2.59 2 ● GPA2.60-3.00 5 ● GPA3.01-3.59 10 ● GPA3.6-4.0 15 B. GPA in Math and Sciences: Intermediate Algebra, Anatomy & Physiology, Microbiology ● GPA2.50-2.59 2 ● GPA2.60-3.00 5 ● GPA3.01-3.59 10 ● GPA3.6-4.0 15 IV. Application Essay to Nursing Program – APA Format 10 Theessaywillinclude: 40

● Statementofpurposeforenrollinginanursingprogram 2 ● Theessentialfunctionsandroleofanurse 2 ● Preparationtobecomesuccessfulinthenursingprogram 2 ● Accountabilityandintegrityinthenursingprofession 2 ● Grammar 2 V. Health Care Background 5 ● Onetothree(1–3)years 3 ● Morethanthree(3)years 5 VI. Personal Interview 20 ● Professionalism 4 ● AppearanceandDemeanor 4 ● CommunicationSkills 4 ● AnsweringSkills 4 ● OverallImpression 4 VII. Evaluation from the Office of Admissions 5 ● Professionalism 1 ● Timeliness 1 ● Communication ● Compliancewiththerequirements 1 ● Self-Motivation 1 Total Possible Points for Criterion I through Criterion VII: 130 Points Transition Course [for LVN-RN Advanced Placement only] The LVN To RN Transition Course (120 hrs) is an Admission Course that must be completed before starting the LVNtoRNCOREcourses. Associate of Science in Physical Therapist Assistant Program (A.S. in PTA) The Physical Therapist Assistant Program has a selective application process. There is a deadline for completed applications to be submitted. Please inquire with Admissions about the current deadline date. 1. All applicants must attend a one-on-one meeting with the Admissions Team advisor to receive specific information about admission requirements, program and clinical rotation scheduling, and financial aid resources. A packet of registration documents will be given to applicants to complete and return. All applicants MUST complete two Admissions Assessment tests. Details will be provided at the informational sessions or by Admissions. 2. All applicants must complete the following prerequisites with grades of ’C’ or above and a GPA of 2.5 or above. All credit granting is subject to approval by the Program Director. Official transcripts are required. a. Anatomy and Physiology with lab (complete one-year sequence within the last five (5) years) b. College-level Math c. College-level English (reading and writing composition) d. Introduction to Psychology or Lifespan Psychology e. OnecourseintheSocialorBehavioralSciences f. Oral Communication,Speech,orInterpersonalCommunication 3. All applicants must submit the Verification of Observation Hours form documenting 80 hours (40 inpatient and 40 outpatient hours) of observation, work experience, or volunteer experience at a physical therapy facility by the application deadline. The Verification of Observation Hours form and instructions are in the Application/Registration packet you can download from the website. 41

4. Applicants must submit all required documents by the application deadline. Only complete applications will be considered. Please plan for time to submit official transcripts and complete observation hours. 5. The PTA Admissions Committee will review all applications and approve the 40 top-scoring applicants for an on-campus interview and essay writing. Please see the scoring rubric. The interview criteria are based upon ’Generic Abilities’ identified through a study published by UW-Madison. Interviews will be scheduled for 15 – 20 minutes. Applicants will also have additional time to complete a short Application Essay and Pre-Admission Questionnaire. Applicants will be remindedtocompletetheironlineFAFSAapplicationforfederalstudentaid. 6. The 20 top-ranking applicants will be offered seats in the program with up to ten (10) alternates. Selected applicants must accept the seat within 72 hours of receiving the formal acceptance letter. A.S. in PTA Admission Point System Please review the PTA Admission Point System table to help you prepare. Applicants not selected may re-apply. The following point system evaluates and ranks each applicant, showing the maximum score achievable. Table 12. A.S. in PTA Admission Point System Point Category: Points Completedapplicationform Required ProofofprerequisiteGPA Average2.50-2.59 1 Average2.60-3.00 2 Average3.01-3.59 3 Average3.6-4.0 4 AnatomygradeofBorA 2 Physiology grade of B or A 2 College degree Associate Degree 1 Bachelor’s Degree 2 Higher Degree 3 AttendInformational Session Required At least 40 hours of observation/experience at a physical therapy Required outpatient facility (must be documented) REQUIRED At least 40 hours of observation/experience at a physical therapy Required inpatient facility (must be documented) REQUIRED 0–249Hours=1Point 250–499Hours=2Point Paid experience in a Physical Therapy Facility 500–749Hours=3Points 750–999=4Points 1000+Hours=5Points Basic AnatomyAssessmentTest 42

0-5 0 6-10 1 11-15 2 16-20 3 21-25 4 CCATAssessmentTest 0-15 0 16-20 1 21-22 2 23-25 3 26orGreater 4 Interview scored by Rubric 12 Essay and pre-admission questionnaire scored by Rubric 4 Total Possible Points 40 Associate of Science in Radiologic Technology Program (A.S. in RT) Applicants must: 1. AttendorviewaliveorrecordedInformationSession. 2. Submit original transcripts from the Registrar at an educational institution for applicants requesting credit granting for some/all General Education courses. Copies are not accepted. All coursework must be completed and given a grade of at least a “C.” Anatomy and Physiology I with Laboratory must be completed within the last five (5) years. All credit granting is subject to the approval of the ProgramDirectororProgramCoordinator.Pleaseallowseven(7)daysforreview. 3. Submit two (2) letters of reference. The letters must be up-to-date, typed, dated, and signed. If there is an electronic signature, the person signing the letter must have a contact phone or email. The references must be from a current supervisor, employer, and/or science or math teacher of a post-secondary institution. The letters need to be tailored to the RT program. 4. Submitaone-pageessayinAPAformatthatincludesthefollowing: a. Statementofwhyyouwouldliketojointhemodality. b. Theessential functions and role of a Technologist in this field. c. Preparation to become successful in this program. d. APA Title page and sources used to prepare for the essay (Title page and sources can be on aseparatepage). 5. Applicants who possess a current State of California Limited Permit (License) in Chest, Extremities, andTorsoSkeletalwill receive credit granting for a portion of the RT program. 6. Gurnick Academy of Medical Arts graduates of the XTMAS program whohavetakenthestateexam and are awaiting the results can enroll as provisional students into the A.S. in RT program. If the graduate fails to earn a license in all three categories listed above, the student will be dropped from theA.S. in RT program for failing to meet all the admission requirements. Associate of Science in RT Admission Point System Applicants are deemed qualified on a point system. The highest-ranked (above a minimum) will be offered seats in the program. The top-scoring candidates will be brought in for the interview process. The following point system evaluates each applicant, showing the maximum score achievable. 43

Table 13. A.S. in RT Admission Point System Points Category: Possible Points I. CCAT 25 25 ● 32orGreater 20 ● 27-31 15 ● 24-26 10 ● 18-23 5 ● 12-17 0 ● 0-11 II. Basic Anatomy Assessment Test 25 25 ● 90-100 20 ● 80-89 10 ● 70-79 5 ● 60-69 0 ● 0-59 III. Post-Secondary Education 45 15 ● AssociateDegree 20 ● BaccalaureateDegreeorhigher 25 ● StateLicenseasanXTthroughtheStateofCaliforniainChest, Extremities, and Torso Skeletal. IV. Academic Achievement: College level GPA 35 A=9pts ● Anatomy B=5pts ● Physiology C=2pts ● CollegeAlgebra A=2pts ● MedicalTerminology B=1.5pts ● Critical Thinking C=1pts ● English ● Sociology If the course was taken more than twice (to include drop/withdrawal), the points would not be counted. V. One-PageResume(required) 15 VI. Essay – One-page, APA Format 20 44

Theessaywillinclude: ● Statementofwhyyouwouldliketojointhismodality ● Theessentialfunctionsandroleofatechnologistinthisfield ● Preparationtobecomesuccessfulinthisprogram ● APATitlepageandsourcesusedtopreparefortheessay(Title pageandsourcescanbeonaseparatepage) VII. Letters of Recommendation 15 Thetwo(2)lettersmustbeup-to-date,typed,dated,andsigned.Ifthereisanelectronicsignature,the personsigningtheletter must have a contact phone or email. The references must be from a current supervisor, employer, and/or science or math teacher of a post-secondary institution. The letters need to be tailored to the RT program. VIII. Health Care Background 60 20 ● Onetothree(1–3)years 30 ● Morethanthree(3)years 30 ● RadiologyCommunityInvolvement Radiology CommunityInvolvementconsistsofvolunteeringinanimagingdepartment,attendinga conference in Radiology or a Career Discussion Panel. A certificate of attendance that is signed and dated will be required for points from Human Resources or a sanctioned event. Every eight hours of documented volunteer time in an imaging department or conference is worth ten (10) points, with a maximum of 30 points. IX. Personal Interview 130 ● InterviewQuestions ● AppearanceandDemeanor ● CommunicationSkills ● Maturity ● OverallImpression ● HolisticEvaluation X. Evaluation from the Office of Admissions 30 Possible Total Points: 400 Associate of Science in Vocational Nursing Program (A.S. in VN) 1. All courses must meet the baseline general education criteria for the California State University system (CSUs). 2. Please note: A transcript MUST be provided for the above prerequisites if credit granting and will only be accepted from an accredited institution approved by the U.S. Department of Education. 3. Copies are not accepted. All coursework must be completed with a grade of at least a “C.” 4. Applicants must have a cumulative grade point average (GPA) of 2.5 (on a 4-point scale) or higher in Vocational or Practical Nursing coursework. Official transcripts are required. 5. Provide proof of graduation from a Board-approved Vocational Nursing Program from an accredited institution or have completed at least 1,530 BVNPT-approved curriculum hours for the VN Program. BachelorofScienceinDiagnosticMedicalImagingProgram(B.S.inDMI) 1. Have completed 2-year or equivalent education and passed an ARRT® registry or equivalent (ARDMS, ARMRIT, etc.) in one of the following: Radiography, Nuclear Medicine, Diagnostic Medical 45

Sonography, Cardiovascular Sonography, MRI, or Radiation Therapy (credit granted for a combinationofpastcorecourseworkandregistryorequivalent=54-semestercredits.) 2. Have completed 16 semester credits of General Education courses that are not a part of the B.S. in DMIProgram. 3. Proof of credentialing certification. 4. Submitofficial transcripts. 5. Completeanapplicationforadmission. 6. HaveahighschooldiplomaorGEDandbeatleast18. 7. Haveareliablecomputer,Internetaccess,andaworkingemailaddress. 8. Per the current fee schedule, they must pay all applicable fees before issuing an enrollment contract or making other payment arrangements acceptable to the school. 9. Meetalladmissionrequirements. BachelorofScienceinNursingProgram(BSN) BSNGenericPathway 1. AttendorviewaliveorrecordedInformationSession. 2. Applicants must meet the following admission policies of Gurnick Academy of Medical Arts: immunization, health screening, background check, and CPR certification (See Policies of Gurnick AcademyofMedicalArtsintheSchoolCatalogand“Admissions”). 3. Applicants must submit a completed application. It is recommended that interested applicants fill outtheapplicationwiththeadmissionadvisor. 4. Applicants must take an Admission Assessment: The Test of Essential Academic Skills (TEAS VII). It tests math, reading, English and language use, and science. All students are encouraged to log on to atitesting.com for study material and other valuable resources and information. The TEAS VII Test Passing score = 64% or better. 5. Applicants will be asked to pass an interview with the Nursing Program Director, Assistant Program Director, or designee in person or via a virtual conferencing platform, if necessary. 6. Applicants must submit a two to three-page (2 – 3) written essay on why they have chosen professional nursing as a career. 7. Applicants must submit three (3) letters of recommendation to the nursing program. These may come from employers, immediateworksupervisors,health-relatedfacilities where the applicant has volunteered, or faculty from previous college/university coursework. These letters of recommendationmustbesubmittedonformalorganizationalstationery. 8. The applicant will submit proof of health-related &/or community work, e.g., volunteering at health fairs, hospitals, or clinics, working with the homeless, mentoring or tutoring other students, Big Brother or Big Sister. These experiences must be substantiated with a document or letter of verification on formal organizational stationery. 9. Applicants will be rank-ordered based on the following score, which includes: ● AdmissionAssessmentTest(TEAS) ● PersonalInterview ● WrittenEssay ● ThreeLettersofRecommendation ● CommunityWork ● Health-RelatedExperience LVNtoBSNPathway 1. Applicants must attend an Information Session. 2. Applicants must meet the following admission policies of Gurnick Academy of Medical Arts: immunization, health screening, background check, and CPR certification (See Policies of Gurnick AcademyofMedicalArtsintheSchoolCatalogand“Admissions”). 46

3. Applicants must submit a completed application. It is recommended that interested applicants fill outtheapplicationwiththeadmissionadvisor. 4. Applicants must complete all prerequisites to the BSN program. 5. Completing the Distance Education Questionnaire for applicants who receive full credit granting of the LVN to BSN or RN to BSN Advanced Placement General Education courses or enrollment and completing an online general education prerequisite course(s) at Gurnick Academy of Medical Arts, as applicable. 6. Applicants must have a cumulative grade point average (GPA) of 2.5 (on a 4-point scale) or higher in all college coursework. Official transcripts are required. 7. Applicants must take the Test of Essential Academic Skills (TEAS VII). It tests math, reading, English and language use, and science. All students are encouraged to log on to www.atitesting.com for study material and other valuable resources and information. The TEAS VII Test Passing score = 64% or better. 8. Applicants will be asked to pass an interview with the Nursing Program Director, Assistant Program Director, or designee in person or via a virtual conferencing platform, if necessary. 9. Applicants must submit a two to three-page (2 – 3) written essay on why they have chosen professional nursing as a career. 10. Applicants must submit three (3) letters of recommendation to the nursing program. These may come from employers, immediateworksupervisors,health-relatedfacilities where the applicant has volunteered, or faculty from previous college/university coursework. These letters of recommendationmustbesubmittedonformalorganizationalstationery. 11. Applicants will submit proof of health-related or community work, e.g., volunteering at health fairs, hospitals, or clinics, working with the homeless, mentoring or tutoring other students, Big Brother or Big Sister. These experiences must be substantiated with a document or letter of verification on formal organizational stationery. 12. Applicants must submit a resume. 13. Applicants must submit transcripts showing proof of completing the 33 credits of General Education courses that comprise Semesters I and II of the BSN Generic Pathway. 14. Applicants will be rank-ordered based on the following score, which includes: ● GPAinprerequisites ● AdmissionAssessmentTest(TEASVII) ● PersonalInterview ● WrittenEssay ● Three(3)LettersofRecommendation ● CommunityWork ● Health-RelatedExperience For LVN-BSN AP Applicants: Submit proof of one year of full-time LVN/LPN work experience within the last three (3) years. Submits proof of graduation from a Board-approved LVN/LPN program from an accredited institution or has completed an LVN/LPN Refresher/Re-entry program within one year of admission. Credit Granting for Nursing Education: Students may request credit granting for previously taken nursing courses. If official transcripts are not submitted at the time of the application, students forfeit the opportunity to apply for credit granting on courses taken previously. LVNs can transfer 24 Semester Credit Hours of courses taken at the post-secondary level to an institution accredited by an agency recognized by the United States Department Of Education or the Council of Higher Education Accreditation. Thecontentofthese24transfercreditsshallincludethefollowing: 47

● NursingTheoryhours(beforetheprogram):15semestercredithoursforthefollowingequivalentcourses at Gurnick Academy of Medical Arts: - RN100FundamentalsofNursing(3semestercredithours) - RN102HealthAssessmentTheory(3semestercredithours) - RN104Pharmacology(3semestercredithours) - RN200Medical-SurgicalNursingITheory-IntrotoMed-Surg(3semestercredithours) - RN202Medical-SurgicalNursingIITheory-IntermediateMed-Surg(3semestercredithours) ● NursingLabhours(beforetheprogram):1.5semestercredithoursfor: - RN103HealthAssessmentSkillsLab(1.5semestercredithours) ● NursingClinicalhours(beforetheprogram):7.5semestercredithoursfor: - RN101FundamentalsofNursingClinicalandLab(3.5semestercredithours) - RN201Medical-SurgicalNursingIClinical(2semestercredithours) - RN203Medical-SurgicalNursingIIClinical (2 semester credit hours) RNtoBSNPathway 1. GraduatefromanapprovedRegisteredNursingprogram. 2. Provide official transcripts that reflect a minimum cumulative GPA of 2.5 in all college coursework. 3. AttendorviewaliveorrecordedInformationSession. 4. Pass an interview with the Program Director or Associate Program Director in person or via a virtual conferencing platform, if necessary. 5. Submit a two to three-page (2 – 3) typed essay on why they have chosen professional nursing as a career. 6. Submit three (3) letters of recommendation. These may come from employers, immediate work supervisors, health-related facilities where the applicant has done volunteer work or faculty from previous college/university courses. These letters of recommendation must be submitted on official letterhead. 7. Provide a resume showing previous healthcare experience. 8. SubmitproofofcurrentRNlicense. 9. Complete all courses or equivalent listed in the Registered Nursing Prerequisite Courses: RN to BSN Pathwaytable. Generic BSN for Non-Registered Nurses and Advanced Placement for LVNs are available as residential programs at the Concord Campus, approved by the California Board of Registered Nursing. BSNAdmissionPointSystem Applicants are deemed qualified on a point system. The highest-ranked (above a minimum) will be offered seats in the program. The following point system evaluates each applicant, showing the maximum score achievable. Table 14. BSN Admission Point System Criteria Possible Points I. Admissions Exam 40 ● TEAS(90.00–100.00) 40 ● TEAS(80.0–89.99) 30 ● TEAS(70.0–79.99) 20 ● TEAS(64.0–69.99) 10 48

Gurnick AcademyofMedicalArtsusestheTestofEssentialAcademic Skills. The minimum composite score is 64% for Bachelor’s Degree Nursing Programadmission.Theprogramwillonlyacceptamaximumoftwo(2) attemptsinoneyear,withthefirstpassingscoreof64%.Ifstudentsdonot attain the minimum 64%onthefirstattempt,theymayretestwithinone (1) year. II. Post-Secondary Education 20 ● AssociateDegree 5 ● BaccalaureateDegree 10 ● Graduate/Master’sDegree 20 III. Academic Achievement: College level Courses & High school AP 30 courses A. GPAinNon-BiologyPrerequisiteCourses:Reading&Composition, Psychology, Public Speaking, Sociology, Critical Thinking, Nutrition ● GPA2.50-2.59 2 ● GPA2.60-3.00 5 ● GPA3.01-3.59 10 ● GPA3.6-4.0 15 B. GPA in Math and Sciences: Intermediate Algebra, Anatomy & Physiology, Microbiology ● GPA2.50-2.59 2 ● GPA2.60-3.00 5 ● GPA3.01-3.59 10 ● GPA3.6-4.0 15 IV. Application Essay To Nursing Program – APA Format 10 Theessaywillinclude: ● Statementofpurposeforenrollingintothenursingprogram. 2 ● Theessentialfunctionsandroleofanurse. 2 ● Preparationtobecomesuccessfulinthenursingprogram. 2 ● Accountabilityandintegrityinthenursingprofession. 2 ● Grammar 2 V. Health Care Background 5 ● Onetothree(1–3)years 3 ● Morethanthree(3)years 5 VI. Personal Interview 20 ● Professionalism 4 ● AppearanceandDemeanor 4 ● CommunicationSkills 4 ● AnsweringSkills 4 ● OverallImpression 4 VII. Evaluation from the Office of Admissions 5 ● Professionalism 1 ● Timeliness 1 ● Communication 1 49

● Compliancewiththerequirements 1 ● Self-Motivation 1 Total Possible Points for Criterion I through Criterion VII: 130 Points BachelorofScienceinRadiationTherapyProgram(B.S.inRT) Applicants Must: 1. AttendorviewaliveorrecordedInformationSession. 2. Meet the following admission policies of Gurnick Academy of Medical Arts: immunization, health screening, background check, and CPR Certification (See Policies of Gurnick Academy of Medical Arts in the School Catalog and “Admissions”). 3. Submit a completed application for the program. It is recommended that interested applicants fill outtheapplicationwiththeadmissionadvisor. 4. Take an Admission Assessment test: Criteria Cognitive Aptitude Test (CCAT) with a minimum score of 25points. 5. Submit original transcripts from the Registrar at a regionally accredited institution for applicants requesting credit granting for some/all General Education courses. Copies are not accepted. All coursework must be completed and given a grade of at least a “C” with a cumulative 2.5 GPA. Anatomy and Physiology with Laboratory must be completed within the last five (5) years. All credit granting is subject to the approval of the Program Director or Program Coordinator. Please allow seven(7)daysforreview. 6. Complete a minimum of 40 hours of clinical observation in a radiation therapy department of their choosing. The student is responsible for securing the radiation therapy department where observation is conducted. All applicants must submit proof of observation hours. Observation hours are to be submitted on the program application timesheet. 7. Submit two (2) professional letters of recommendation and two (2) radiation therapy letters of recommendation. Letters will be submitted directly to the admission advisor. These may come from employers, immediate work supervisors, health-related facilities at which the applicant has done observation time, or faculty from previous college/university coursework. These letters of recommendationmustbesubmittedonformalorganizationalstationery. 8. Submit a two to three (2 – 3) page-written essay on why they have selected the radiation therapy profession. 9. Submitaprofessionalresume. 10. Participate in an interview with the Radiation Therapy Admission Committee. 11. Applicants will be rank-ordered based on the following score, which includes: o AdmissionAssessmentTest(CCAT) o Qualityofthegradesinprerequisitecourses o Knowledgeoftheprofession o Writtenessay o Rankedinterview o Two(2)Professionallettersofrecommendation o Two(2)Therapistlettersofrecommendation Bachelor of Science in RT Admission Point System Applicants will be accepted to the program based on rank. The highest-ranking individuals will only be accepted. Students will be accepted based on geographic regions. Students may prefer the geographic area where they are accepted; however, they will be accepted based on rank. Students unwilling to relocate to the geographic region they are accepted in will not be allowed to join the program. Geographic change requests will not be considered. Table 15. B.S. in RT Admission Point System 50

Criteria Possible Points I. Admissions Exam 50 ● CCAT(minimumscore25points) 50 II. Application Essay to Radiation Therapy Program – APA Format 10 Essay will include: ● StatementofPurposeforenrollingintheRadiation 4 Therapyprogram 2 ● PreparationtobecomingsuccessfulintheRadiationTherapy program 2 ● Clarityofthoughtsandinsights 2 ● WritingSkillsandGrammar III. Professional Letters of Recommendation (2) 15 Scores will be added, and average scores will be taken: ● GeneralRecommendation 5 ● Initiative Score 5 ● CommunicationScore 5 IV. Therapist Letters of Recommendation (2) 15 Scores will be added. Average scores will be taken: ● GeneralRecommendation 5 ● Initiative Score 5 ● CommunicationScore 5 V. Personal Interview 40 Scores will be added, and average scores will be taken: ● Communication 5 ● Knowledge 5 ● Initiative 5 ● Motivation 5 5 ● ConflictManagement 5 ● AttitudeforSuccess 5 ● TimeManagement 5 ● StudyHabits BoneDensitometryTechnicianProgram(DXA) 1. Submitanessay(nolongerthantwo(2)pages,typed,double-spaced)thatdescribesthefollowing: a. Reasonsfortheapplicant’sdesiretobecomeaBoneDensitometryTechnician. b. The applicant’s attributes that will support the profession and their ability to complete the DXAprogram. c. Describe the support system, such as a person, time management, and resources to supporttheapplicant’s efforts and success in the program. 2. In some campuses, the applicant pool may be larger than the number of available seats at the desired campus. In this case, the campus may require an additional step, an interview with the ProgramDirector, Assistant Program Director, or designees. BoneDensitometryTechnician(DXA)AdmissionPointSystem Applicants are deemed qualified on a point system. The highest-ranked (above a minimum) will be offered seats in the program. The following point system evaluates each applicant, showing the maximum score achievable. 51

Table 16. DXA Admission Point System Points Category: Possible Points I. Admissions Exam - CCAT 25 25 ● 32orGreater 20 ● 27-31 15 ● 24-26 10 ● 18-23 5 ● 12-17 0 ● 0-11 II. Post-Secondary Education 20 10 ● GurnickAcademyofMedicalArtsGraduateorCurrentlyEnrolled 15 ● AssociateDegree/MilitaryService 20 ● BaccalaureateDegree III. Academic Achievement: College level Courses or High school courses 50 (whicheverishigher) A. Overall High School GPA 5 ● GPA3.0 10 ● GPA3.5 15 ● GPA3.9 B. Overall College GPA 20 ● GPA3.0 30 ● GPA3.5 35 ● GPA3.9 IV. One-Page Resume(required) 25 V. Essay – One-page, APA Format 25 Theessaywillinclude: - Statementofwhyyouwouldliketojointhismodality. - Theessential functions and role of a technician in this field. - Preparation to become successful in this program. - Sources used to prepare for the essay. VI. Health Care Background 20 10 ● Onetothree(1–3)years 20 ● Morethanthree(3)years VII. Evaluation from the Office of Admissions 35 Possible Total Points: 200 52

DentalAssistant Program(DA) All applicants must: 1. Be at least 17 to be admitted to the program with a parent’s or guardian’s consent. Applicants must beatleast18atthebeginningoftheClinicalExternship. 2. Submit an essay (no longer than one (1) page, double-spaced, typed, or handwritten) that describes thefollowing: a. Reasonfortheapplicant’sdesiretobecomeaDentalAssistant. b. Theapplicant’s attributes that will support their ability to complete the DA program. c. The applicant has people, routines, and resources to support the applicant’s efforts throughouttheprogram. MedicalAssistantProgram(MA) All applicants must: 1. Beatleast17tobeadmittedtotheprogramwithparentorguardianconsent.Applicantsmustbeat least 18 at the beginning of the Clinical Externship. 2. Submit an essay (no longer than one (1) page, double-spaced, typed, or handwritten) that describes thefollowing: a. Reasonsfortheapplicant’sdesiretobecomeaMedicalAssistant. b. Theapplicant’s attributes that will support their ability to complete the MA program. c. The applicant has available people, routines, and resources to support the applicant’s efforts throughout the program. 3. Some Campuses (such as if the applicant pool is larger than the number of available seats at the desired campus location) may require an additional step: an interview with the MA Program Supervisor, Program Coordinator, or designee. MasterofScienceinNursingProgram(BSNtoMSNPathway) Applicants Must: 1. Meet the following admission policies of Gurnick Academy of Medical Arts: immunization, health screening, background check, and CPR Certification (See Policies of Gurnick Academy of Medical Arts in the School Catalog and “Admissions”). 2. Submit a completed application for the program. It is recommended that interested applicants fill outtheapplicationwiththeadmissionadvisor. 3. SubmitproofofcurrentRNlicense. 4. Submit official transcripts from an accredited institution showing the obtained BSN degree with the graduation date. Copies are not accepted. 5. Haveacumulative3.0GPA(ona4-pointscale)orhigherinallcollegecoursework. 6. Submita3-pagetypedStatementofPurposeorLetterofIntent. 7. Submit three (3) letters of recommendation to the nursing program. These may come from employers, immediate work supervisors, health-related facilities where the applicant has volunteered, or faculty from previous college/university coursework. These letters or recommendationsmustbesubmittedonformalorganizationalstationery. 8. Submit proof of health-related or community work, e.g., volunteering at health fairs, hospitals, clinics, working with the homeless, mentoring or tutoring other students, Big Brother or Big Sister. These experiences must be substantiated with a document or letter of verification on formal organizational stationery. 9. Applicants will be asked to pass an interview with the Nursing Program Director or Associate ProgramDirectorinpersonorviaGoogleMeet,ifnecessary. 10. Applicants will be rank-ordered based on the following score, which includes: o GPAinPrerequisiteCourses 53

o PersonalLettersofRecommendation o CommunityWork o HealthRelatedExperience Table 17. BSN to MSN Admission Point System Criteria Possible Points I. Academic Achievement: UndergraduateLevelCourses 20 A. GPA ● GPA3.00-3.59 10 ● GPA3.60-4.00 20 II. Post-Secondary Education 20 ● BaccalaureateDegree 10 ● Graduate/Master’sDegree 20 III. Application Essay to Nursing Program – APA Format 10 Theessaywillinclude: ● StatementofpurposeforenrollingintotheMSNprogram 2 ● Theessentialfunctionsandroleofgraduatedegreenurse 2 ● PreparationtobecomesuccessfulintheMSNprogram 2 ● Accountabilityandintegrityinthenursingprofession 2 ● Grammar 2 IV. Health Care Background 5 ● Onetothree(1–3)years 3 ● Morethanthree(3)years 5 V. Personal Interview 20 ● Professionalism 4 ● AppearanceandDemeanor 4 ● CommunicationSkills 4 ● AnsweringSkills 4 ● OverallImpression 4 VI. Evaluation from the Office of Admissions 5 ● Professionalism 1 ● Timeliness 1 ● Communication 1 ● Compliancewiththerequirements 1 ● Self-Motivation 1 Vocational Nurse (VN) Program All applicants must: 1. Be at least 17 to be admitted to the Essential Medical Bioscience prerequisites course with a parent’s or guardian’s consent. Applicants must be at least 18 at the beginning of the core program. 2. CompletetheEssentialMedicalBioscienceprerequisitescoursewithapassinggradeasidentifiedin thesyllabus. a. The Essential Medical Bioscience course is waived as a prerequisite for those who have completed the following courses within the last five (5) years: Cell Biology, Human Biology Basics, Basic Math, and Medical Terminology. A prerequisite course challenge exam is also available for those who are interested. 54

3. Some Campuses (such as if the applicant pool is larger than the available seats at the desired campus location) may require an additional step: an interview with the applicable VN/PT Program Coordinator or designee. VNAdmissionPointSystem Kindly note that the following table may not apply to some of our campuses. Some campuses may have non-interview enrollment. Please ask an Admission Advisor at the respective campus for more details. Table 18. VN Admission Point System Criteria Possible Points CCAT 3 Score 16-24 1 Score 25-34 2 Score 35-45 3 AdmissionsEssay 6 Resume 6 Previous Education 3 HSdiplomaorGED 1 AA/ASdegree 2 BA/BSdegreeandhigher 3 HealthcareField Experience (per resume) 3 One(1)year 1 Twotofour(2–4)years 2 Morethanfour(4)years 3 Prerequisite Course Grades – Gurnick Academy of Medical Arts 20 (Points do not apply if credit granted) A 20 B 15 C 10 Prerequisite Attendance 15 Missedzero(0)classes 15 Missedone(1)class 10 Missedtwo(2)classes 2 Interview Assessment 75 Interview questions 50 Appearance/Presentation 5 Communicationskills 5 55

Problem-solving/Decision-making 5 Preparedness 5 Responsibility 5 Total Possible Points for Available: 131 Points X-ray Technician with Medical Assistant Skills Program (XTMAS) 3. Submitanessay(nolongerthantwo(2)pages,typed,double-spaced)thatdescribesthefollowing: a. Reasonsfortheapplicant’sdesiretobecomeanX-rayTechnician. b. The applicant’s attributes that will support the profession and their ability to complete the XTMASprogram. c. Describe the support system, such as a person, time management, and resources to supporttheapplicant’s efforts and success in the program. 4. In some campuses, the applicant pool may be larger than the number of available seats at the desired campus. In this case, the campus may require an additional step, an interview with the ProgramDirector, Assistant Program Director, or designees. 5. After submitting transcripts, students who have completed a Medical Assistant diploma program with the equivalent approved medical assistant skills content may apply to receive transfer credit if theappropriatemedicalassisting coursework was taken and passed within the past five (5) years. 6. AdvancedStandingapplicantsmustprovideofficialtranscripts from a Medical Assistant program. X-ray Technician with Medical Assistant Skills (XTMAS) Admission Point System Applicants are deemed qualified on a point system. The highest-ranked (above a minimum) will be offered seats in the program. The following point system evaluates each applicant, showing the maximum score achievable. Table 19. XTMAS Admission Point System Points Category: Possible Points I. Admissions Exam - CCAT 25 25 ● 32orGreater 20 ● 27-31 15 ● 24-26 10 ● 18-23 5 ● 12-17 0 ● 0-11 II. Post-Secondary Education 30 20 ● GurnickAcademyofMedicalArtsGraduateorCurrentlyEnrolled 25 ● AssociateDegree/MilitaryService 30 ● BaccalaureateDegree III. Academic Achievement: College level Courses & High school courses 50 A. Overall High School GPA 5 ● GPA3.0 56

10 ● GPA3.5 15 ● GPA3.9 B. Overall College GPA 20 ● GPA3.0 30 ● GPA3.5 35 ● GPA3.9 IV. One-Page Resume(required) 25 V. Essay – One-page, APA Format 25 Theessaywillinclude: - Statementofwhyyouwouldliketojointhismodality. - Theessential functions and role of a technician in this field. - Preparation to become successful in this program. - Sources used to prepare for the essay. VI. Health Care Background 30 20 ● Onetothree(1–3)years 30 ● Morethanthree(3)years VII. Evaluation from the Office of Admissions 40 Possible Total Points: 225 INTERNATIONALNURSEGRADUATEPROGRAM Tobeconsideredforadmissionintothenursingcourses,ALLapplicantsmustmeetthefollowingcriteria: 1. Official Transcript and evaluation of courses from an approved credential evaluator. 2. Official Letter from the California Board of Registered Nursing stating the candidate’s specific area of deficiency. 3. Applicants must meet the following admission policies of Gurnick Academy of Medical Arts: immunization, health screening, background check, and CPR certification (See Policies of Gurnick AcademyofMedicalArtsintheSchoolCatalogand“Admissions”). 4. Applicants must submit a completed application. It is recommended that interested applicants fill outtheapplicationwiththeadmissionadvisor. 5. Applicants must have graduated from high school or earned a GED and be at least 18. 6. Applicants must pay all applicable fees before issuing an enrollment contract or making other paymentarrangementsacceptabletotheschoolperthecurrentpublishedfeeschedule. 7. Applicants must pass the written Competency Exam for Basic and Intermediate Medical-Surgical Nursing with a minimumscoreof75%. 8. Applicants will be asked to pass an interview with the Nursing Program Director or Associate ProgramDirectorinpersonorviaavirtualconferencingplatform,ifnecessary. 9. Applicants must submit a two to three-page (2 – 3) written essay on why they have chosen professional nursing as a career. 10. Applicants must submit three (3) letters of recommendation to the nursing program. These may come from employers, immediateworksupervisors,health-relatedfacilities where the applicant has volunteered, or faculty from previous college/university coursework. These letters of recommendationmustbesubmittedonformalorganizationalstationery. 11. Applicants will be rank-ordered based on the following score, which includes: 57

● PersonalInterview ● WrittenEssay ● Three(3)LettersofRecommendation ** If enrollment openings are fewer than applicants that meet the admission requirements, applicants will be askedtopassaninterviewwiththeNursingProgramDirectororAssociateProgramDirector. MinimumRequirementsforStudentsEnrollinginDistanceEducationCourses MinimumStudentSkillsRequirements Students are expected to have at least the following skills before taking distance education courses: ● Basickeyboardingcompetence ● Elementaryknowledgeoftheircomputeroperatingsystem ● Basicknowledgeof ○ Wordprocessor ○ Sendingandreceivingemailswithattachments ○ Usinganinternetbrowserandsearchengine HardwareRequirements ● Access to a modern Windows 10, macOS 12 or newer. For other operating systems,pleasecontact IT support with your questions. ● Internetaccesswithahigh-speedbroadbandconnection. ● Internet service provider for home access and access from work (must have before the start of the course). ● Accessthedistanceeducationenvironmentforatleastten(10)hoursperweek. ● Studentsmustbeabletovideoconferenceinrealtime.Appropriateequipmentmayinclude o Camera(whichcouldbebuiltintothelaptop). o Microphone(couldbebuiltintothelaptop). SoftwareRequirements ● GoogleChromeinternetbrowser. ● AnofficesuitetoolsuchasGSuite,MicrosoftOffice365,LibreOffice,ApacheOpenOffice,etc. ● Oneormorecoursesmayrequirespecialpluginstoaccessstreamingmedia,PDFfiles,orotherweb components. ● AntivirussoftwarelikeMicrosoftDefender. ● AconferencingtoollikeGoogleHangoutsorZoom. Security Requirements UpdateRegularly Install all software updates promptly, including operating system and application updates. This helps patch vulnerabilities and protect against known threats. Strong Passwords Useastrongpasswordwithamixofuppercaseandlowercaseletters,numbers,andsymbols. Avoidusingeasily guessable information like your name, birthday, or pet’s name. Enabletwo-factor authentication for an extra layer of security where possible. Virus and MalwareScans Regularly scan your computer for viruses and malware using a reputable antivirus program. Updateyourantivirusprogramregularlytoensureitseffectiveness. 58

SecureWi-Fi WhenaccessingGurnickAcademyresources,onlyusesecureWi-Finetworks. AvoidusingpublicWi-Finetworks,astheyarelesssecureandmoreexposedtohacking. Additional Security Tips Becautiousaboutclickingonlinksoropeningattachmentsfromunknownsenders. KeepyourGurnickAcademycredentialsprivatefromothers. Backupyourdataregularlytoensureyoucanrecoveritifyourcomputerislostordamaged. If you travel and need to access Gurnick Academy resources on public Wi-Fi, always use a VPN (Virtual Private Network) connection. A VPN encrypts your data and helps protect it from hackers. Enable automatic session lock when you step away from your computer. This prevents unauthorized access if your computer is left unattended. PERFORMANCEREQUIREMENTS Each program has physical and non-physical requirements to ensure our students’ and patients’ safety and welfare. Almost all of our students (check with an Admission Advisor if applicable) must be able to: ● Handlestressfulsituationsrelatedtotechnicalandproceduralstandardsandpatientcaresituations. ● RespondquicklyandappropriatelytoemergenciesusingtheEnglishlanguage. ● CommunicateeffectivelywithpatientsandstaffinverbalandwrittenformsinclearEnglish. ● Readandinterpret(orlearnhowto)patientchartsandrequisitions. ● Toleratestrong,unpleasantodors. ● Providephysicalandemotionalsupporttothepatientsduringprocedures. ● Reportclearlyandlegiblythroughprogressnotesinpatientcharts. ● Meetclassstandardsforsuccessfulcoursecompletion. ● Collect,interpret, and integrate data about patients. ● Recognize and respond appropriately to individuals of all ages, genders, and races across socioeconomic, religious, and cultural backgrounds. ● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalconditions. ● Recognizeandrespondappropriatelytopotentiallyhazardoussituations. ● Demonstratethephysicalandemotionalcapacitytoworka40-hourweekduringclinicalrotation. ● Behave ethically, soundly, competent, compassionately, and professionally in the classroom and the clinic. ● Lift/carry: ○ One (1) pound (0.45 kilograms) – five (5) pounds (2.27 kilograms) frequently – image receptors, lead aprons, files ○ 20 pounds (9.07 kilograms) – 50 pounds (22.68 kilograms) occasionally – patient transfers andpatientpositioning ○ 50 pounds (22.68 kilograms) – 70 pounds (31.75 kilograms) rarely to occasionally – patient transfers ● Standandwalkforuptoeight(8)hoursperday. ● Carryaminimumof20pounds(9.07kilograms)whilewalkingadistanceof100feet(30.48m). ● Bendorflextheuppertrunkforwardto45degreesandthelowertorsointoasquattingposition. ● Rotatetheuppertrunkto30degreestotherightandleft. ● Reachatleast72inches(1.83m)abovefloorlevelorarm’sreach. ● Utilizethesenseofhearingtocommunicateeffectivelywiththepatientsandhealthcareteam. ● Utilize the sense of vision in all hospital lighting levels, varying from low illumination to bright light levels. ● Sitinclassforuptosix(6)hoursperday. 59

● Palpateanatomicalstructuresandhandleinjuredbodypartswithoutcausinginjurytothepatient. ● Duringexercise,givemanualresistancetoapatient’sarm,leg,ortrunk. ● Movewithadequateagilityandspeedtoensurepatientsafety. ● Walkandbalance well enough to help patients walk and transfer with or without equipment while preventing injury to patients and themselves. ● Safelygraspandmanipulatesmallobjectsandsetdialsonelectricalequipment. ● Usevisual,auditory,andtactilesensestoobservepatientsandcollectandinterpretdata. ● Respondtowarningsounds,machinealarms,andcallsforhelp. Please read further to find additional requirements. Please note some requirements may overlap with the abovelist. Program-Specific Performance Requirements Associate of Occupational Science in Cardiac Ultrasound Technology Program (A.O.S. in CUT) A.O.S. in CUT students must be in good health and able to: ● Liftmorethan50pounds(22.68kg)andpush-and-pullroutinely. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Possessadequatevisualacuitytoreviewsonograms,includingcolordistinctions. ● Standandwalkonyourfeet80%ofthetime. ● Reachintermittentlyatoraboveshoulderlevelfor90%oftheworktime. ● Workcompassionatelyandeffectivelywithsickpatients. A.O.S. in CUT students must have sufficient strength, motor coordination, and manual dexterity to: ● Transport, move, lift, and transfer patients from a wheelchair or cart to a sonography table or a patient bed. ● Move,adjust, and manipulatevarioussonographicequipment,includingthephysicaltransportation of mobile sonographic machines, to complete examinations on the patient according to established proceduresandstandardsofspeedandaccuracy. A.O.S. in CUT students must also be capable of: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● Provide physical and emotional support to the patient during the sonographic procedures, respond to situations requiring first aid, and provide emergency care to the patient without, or until, the physician arrives. ● Communicatingverballyinaneffectivemannertodirectpatientsduringsonographicexaminations. ● VisuallyrecognizinganatomyonCRTscreen. ● Readingandinterpretingpatientchartsandrequisitionsforsonographicexaminations. A.O.S. in CUT students must have the mental and intellectual capacity to: ● Calculate and select proper technical factors according to the individual needs of the patient and therequirementsoftheprocedure’sstandardsofspeedandaccuracy. ● Review and evaluate the recorded images on a CRT and archiving system for identifying patient pathology, if present, accurate procedural sequencing, completion of a diagnostic examination, and other appropriate and pertinent technical qualities. Associate of Occupational Science in Respiratory Care Program (A.O.S. in RC) A.O.S. in RC students must be in good health and able to: ● Lift more than 50 pounds (22.68 kg) and push-and-pull routinely. Patient weight can easily exceed 60

500 lbs. Students should not attempt moving patients at any weight that exceeds their physical ability and must wait for appropriate help when personal limitations are met. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Possess adequate visual acuity to review diagnostic reports and ventilator graphics, including color distinctions. ● Standandwalkonyourfeet80%ofthetime. ● Reachintermittentlyatoraboveshoulderlevelfor90%ofworktime. ● Workcompassionatelyandeffectivelywithsickpatients. A.O.S. in RC students must have sufficient strength, motor coordination, and manual dexterity to: ● Transport,lift, and transfer patients from a wheelchair or cart to a patient bed or Gurney. ● Move, adjust, and manipulate various respiratory-related equipment, including the physical transportation of Ventilators, NIVs, Chest Oscillators, High Flow, and other respiratory-related equipment. A.O.S. in RC students must also be capable of: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● Provide physical and emotional support to the patient during procedures, respond to situations requiring first aid, and provide lifesaving emergency care to the patient without, or until, the physician arrives. ● Communicatingverballyinaneffectivemannertodirectpatientsduringproceduresandtests. ● Visuallyrecognizinganatomyonimagingreports. ● Readingandinterpretingpatientchartsandrequisitionsforexaminations. A.O.S. in RC students must have the mental and intellectual capacity to: ● Calculate and select proper technical factors according to the individual needs of the patient and therequirementsoftheprocedure’sstandardsofspeedandaccuracy. ● Review and evaluate the patient diagnosis based on laboratory data and offer appropriate suggestions to the medical staff to improve the overall impression of the patient. Associate of Occupational Science in Radiologic Technology Program (A.O.S. in RT) A.O.S. in RT students must have the following abilities: ● Liftmorethan50pounds(22.68kilograms). ● Beabletopushandpullroutinely. o One (1) pound (0.45 kilograms) – five (5) pounds (2.27 kilograms) frequently – image receptors, lead aprons. o 20pounds(9.07 kilograms) – 70 pounds (31.75 kilograms) occasionally – patient transfers andpositioning. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Mustbeabletomovequicklyonthefeet. ● Possessadequatevisualacuitytoreviewradiographsinvaryingbrightnesslevels. ● Standandwalkonyourfeet80%ofthetime. ● Reachatoraboveshoulderlevelfor90%ofworktime. ● Bendorflextheuppertrunkforwardto45degreesandthelowertorsointoasquattingposition. ● Rotatetheuppertrunkto30degreestotherightandleft. ● Workcompassionatelyandeffectivelywithsickpatients. A.O.S. in RT students must have sufficient strength, motor coordination, and manual dexterity to 61

● Transport, move, lift, and transfer patients from a wheelchair or cart to an x-ray table or a patient bed. ● Move,adjust,andmanipulatevariousmobileandnon-mobilenuclearmedicineequipment. ● Complete examinations on the patient according to established policies and procedures with speed andaccuracy. A.O.S. in RT students must also be capable of: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● Providingphysicalandemotionalsupporttothepatientduringtheradiographicprocedures. ● Ability to respond to situations requiring first aid and provide emergency care to the patient without or until the physician arrives. ● Communicatingverballyinaneffectivemannertodirectpatientsduringradiographicexaminations. ● Visuallyrecognizinganatomyonacomputermonitor. ● Readingandinterpretingpatientchartsandrequisitionsforradiographicexaminations. ● Respondtowarningsounds,machinealarms,andcallsforhelp. A.O.S. in RT students must have the mental and intellectual capacity to ● Calculate and select proper technical factors according to the individual needs of the patient and the requirementsoftheprocedure’sstandardsofspeedandaccuracy. ● Review and evaluate the recorded images on a computer monitor and archiving system for identifying patient pathology, if present, accurate positioning and technical factors for completion of adiagnostic examination, and other appropriate and pertinent technical qualities. ● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalsituations. ● Behave ethically, soundly, competently, compassionate, and professionally in the classroom and the clinic. Associate of Occupational Science in Ultrasound Technology Program (A.O.S. in UT) A.O.S. in UT students must be in good health and able to: ● Liftmorethan50pounds(22.68kilograms)andpush-and-pullroutinely. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Possessadequatevisualacuitytoreviewsonograms,includingcolordistinctions. ● Standandwalkonyourfeet80%ofthetime. ● Reachintermittentlyatoraboveshoulderlevelfor90%ofworktime. ● Workcompassionatelyandeffectivelywithsickpatients. A.O.S. in UT students must have sufficient strength, motor coordination, and manual dexterity to ● Transport, move, lift, and transfer patients from a wheelchair or cart to a sonography table or a patient bed. ● Move,adjust, and manipulatevarioussonographicequipment,includingthephysicaltransportation of mobile sonographic machines, to complete examinations on the patient according to established proceduresandstandardsofspeedandaccuracy. A.O.S. in UT students must also be capable of: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● Provide physical and emotional support to the patient during the sonographic procedures, respond to situations requiring first aid, and provide emergency care to the patient without, or until, the physician arrives. ● Communicatingverballyinaneffectivemannertodirectpatientsduringsonographicexaminations. ● VisuallyrecognizinganatomyonCRTscreen. 62

● Readingandinterpretingpatientchartsandrequisitionsforsonographicexaminations. A.O.S. in UT students must have the mental and intellectual capacity to ● Calculate and select proper technical factors according to the individual needs of the patient and therequirementsoftheprocedure’sstandardsofspeedandaccuracy. ● Review and evaluate the recorded images on a CRT and archiving system for identifying patient pathology, if present, accurate procedural sequencing, completion of a diagnostic examination, and other appropriate and pertinent technical qualities. Associate of Occupational Science in Vascular Ultrasound Technology Program (A.O.S. in VUT) A.O.S. in VUT students must be in good health and able to: ● Liftmorethan50pounds(22.68kilograms)andpush-and-pullroutinely. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Possessadequatevisualacuitytoreviewsonograms,includingcolordistinctions. ● Standandwalkonyourfeet80%ofthetime. ● Reachintermittentlyatoraboveshoulderlevelfor90%ofworktime. ● Workcompassionatelyandeffectivelywithsickpatients. A.O.S. in VUT students must have sufficient strength, motor coordination, and manual dexterity to ● Transport, move, lift, and transfer patients from a wheelchair or cart to a sonography table or a patient bed. ● Move,adjust, and manipulatevarioussonographicequipment,includingthephysicaltransportation of mobile sonographic machines, to complete examinations on the patient according to established proceduresandstandardsofspeedandaccuracy. A.O.S. in VUT students must also be capable of: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● Provide physical and emotional support to the patient during the sonographic procedures, respond to situations requiring first aid, and provide emergency care to the patient without, or until, the physician arrives. ● Communicatingverballyinaneffectivemannertodirectpatientsduringsonographicexaminations. ● VisuallyrecognizinganatomyonCRTscreen. ● Readingandinterpretingpatientchartsandrequisitionsforsonographicexaminations. A.O.S. in VUT students must have the mental and intellectual capacity to ● Calculate and select proper technical factors according to the individual needs of the patient and therequirementsoftheprocedure’sstandardsofspeedandaccuracy. ● Review and evaluate the recorded images on a CRT and archiving system for identifying patient pathology, if present, accurate procedural sequencing, completion of a diagnostic examination, and other appropriate and pertinent technical qualities. Associate of Science in Magnetic Resonance Imaging Program (A.S. in MRI) A.S. in MRI students must be in good health and able to: ● Liftmorethan50pounds(22.68kilograms)andpush-and-pullroutinely. ● Hearsufficiently to assess patient needs without hearing aids and communicate verbally with other healthcare providers. ● VerbalizeandhavewrittenskillstocommunicateneedspromptlyandeffectivelyinEnglish. ● Havefulluseofarms,hands,andwrists. ● Possessadequatevisualacuitytoreviewradiologicexams,includingcolordistinctions. 63

● Standandwalkonyourfeet80%ofthetime. ● Workcompassionatelyandeffectivelywithillpatients. A.S. in MRI students must have sufficient strength, motor coordination, and manual dexterity to ● Transport,lift, and transfer patients from a wheelchair or cart to a table or bed. ● Move,adjust,andmanipulatevariousMRIequipment. A.S. in MRI students must be capable of: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● ProvidingphysicalandemotionalsupporttothepatientduringtheMRIprocedures. ● Ability to respond to situations requiring first aid and providing emergency care to the patient withoutoruntilthephysicianarrives. ● CommunicatingverballyinaneffectivemannertodirectpatientsduringMRIexaminations. ● VisuallyrecognizinganatomyonCRTscreen. ● ReadingandinterpretingpatientchartsandrequisitionsforMRIexaminations. A.S. in MRI students must have the mental and intellectual capacity to ● Calculate and select proper technical factors according to the individual needs of the patient and therequirementsoftheprocedure’sstandardsofspeedandaccuracy. ● Review andevaluatetherecordedimagesonthemonitorandarchivingsystemforassessingtheMR image quality, accurate procedural sequencing, completion of a diagnostic examination, and other appropriate and pertinent technical qualities. Associate of Science in Nuclear Medicine Technology Program (A.S. in NM) A.S. in NM students must have the following abilities: ● Liftover50pounds(22.68kilograms). ● Beabletopushandpullroutinely. o One(1)pound(0.45kilograms)–five(5)pounds(2.27kilograms)frequently–leadaprons, files, lead syringes. o 20pounds(9.07 kilograms) – 70 pounds (31.75 kilograms) occasionally – patient transfers andpositioning. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Mustbeabletomovequicklyonthefeet. ● Sitinclassforuptoeight(8)hoursperday. ● Standandwalkonyourfeet80%ofthetime. ● Reachatoraboveshoulderlevelfor90%ofworktime. ● Bendorflextheuppertrunkforwardto45degreesandthelowertorsointoasquattingposition. ● Rotatetheuppertrunkto30degreestotherightandleft. ● Workcompassionatelyandeffectivelywithsickpatients. A.S. in NM students must have sufficient strength, motor coordination, and manual dexterity to ● Transport,lift, and transfer patients from a wheelchair or cart to an imaging table or bed. ● Move, adjust, and manipulate various radiographic equipment, including portables and C-arm equipmentphysicaltransportation. ● Completepatientexaminationsperestablishedpoliciesandprocedureswithspeedandaccuracy. A.S. in NM students must also be capable of: ● Handlestressfulsituationsrelatedtotechnicalandproceduralstandardsandpatientcaresituations. 64

● Providephysicalandemotionalsupporttothepatientduringtheimagingprocedures. ● Respondtosituationsrequiringfirstaidandprovidingemergencycaretothepatientwithoutoruntil thephysician arrives. ● Communicateverballyinaneffectivemannertodirectpatientsduringimagingexaminations. ● Recognizeanatomyonacomputermonitor. ● Addresswarningsounds,machinealarms,andcallsforhelp. A.S. in NM students must have the mental and intellectual capacity to ● Calculate and administer radiopharmaceutical doses under the supervision of a licensed nuclear medicinetechnologist following department protocol and procedures. ● Review and evaluate the recorded images on a computer monitor and archiving system to identify patient anatomy and pathology. ● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalsituations. ● Behave ethically, soundly, competently compassionate, and professionally in the classroom and the clinic. Associate of Science in Nursing Program (ADN) Each program hasphysical and non-physical requirements to ensure students’ and patients’ safety and welfare. Almostall of our students (check with an Admission Advisor if applicable) must be able to: ● Handlestressfulsituationsrelatedtotechnicalandproceduralstandardsandpatientcaresituations. ● RespondquicklyandappropriatelytoemergenciesusingtheEnglishlanguage. ● CommunicateeffectivelywithpatientsandstaffinverbalandwrittenformsinclearEnglish. ● Readandinterpret(orlearnhowto)patientchartsandrequisitions. ● Toleratestrong,unpleasantodors. ● Providephysicalandemotionalsupporttothepatientsduringprocedures. ● Reportclearlyandlegiblythroughprogressnotesinpatientcharts. ● Meetclassstandardsforsuccessfulcoursecompletion. ● Collect,interpret, and integrate data about patients. ● Recognize and respond appropriately to individuals of all ages, genders, and races across socioeconomic, religious, and cultural backgrounds. ● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalconditions. ● Recognizeandrespondappropriatelytopotentiallyhazardoussituations. ● Demonstratethephysicalandemotionalcapacitytoworka40-hourweekontheclinicalrotation. ● Behave ethically, soundly, competently, compassionate, and professionally in the classroom and the clinic. ● Requiresintermittentsitting, standing, and walking up to eight (8) hours per day. ● Requiresbending, squatting,kneeling, twisting, and reaching. ● Requires frequentlifting and carrying 25 pounds (11.34 kilograms) – 50 pounds (22.68 kilograms). ● Requires pushingorpullingupto100pounds(45.36kilograms). ● Utilizethesenseofhearingtocommunicateeffectivelywiththepatientsandhealthcareteam. ● Utilize the sense of vision in all hospital lighting levels, varying from low illumination levels to bright light levels. ● Sitinclassforuptosixtoeight(6–8)hoursperday. ● Palpateanatomicalstructuresandhandleinjuredbodypartswithoutcausinginjurytothepatient. ● Duringexercise,givemanualresistancetoapatient’sarm,leg,ortrunk. ● Movewithadequateagilityandspeedtoensurepatientsafety. ● Walkandbalance well enough to help patients walk and transfer with or without equipment while preventing injury to patients and themselves. ● Safelygraspandmanipulatesmallobjectsandsetdialsonelectricalequipment. ● Usevisual,auditory,andtactilesensestoobservepatientsandcollectandinterpretdata. ● Respondtowarningsounds,machinealarms,andcallsforhelp. 65

Associate of Science in Physical Therapist Assistant Program (A.S. in PTA) To be successful in the PTA classroom, lab, and clinical settings and ultimately successful as a physical therapist assistant, students must possess the intelligence, integrity, compassion, humanitarian concerns, and physical and emotional capacity necessary to practice physical therapy. At a minimum, students must possess the following essential skills: Critical Thinking – calculation, problem-solving, reasoning, and judgment ● Collect,document,interpret,andanalyzewritten,verbal,andobserveddataregardingpatients. ● Prioritize multiple tasks, integrate information, and make effective decisions. ● Actsafelyandethicallyinphysicaltherapysettings. ● Recognizethedifferencebetweenfactsandopinions. ● Exercisegoodjudgmentintheclassroom,lab,andclinical/professionalsettings. Interpersonal and Behavioral Skills – working with others, resolving conflicts, offering support ● Establishproductiveworkingrelationships. ● Foster cooperative relationships with classmates, instructors, healthcare providers, patients, and their families. ● Ability to work with lab partners, patients, and others under stressful conditions, including but not limited to medically or emotionally unstable individuals and situations requiring rapid adaptations or emergencyinterventions. ● Appropriate maturity, emotional stability, and empathy to establish effective and harmonious relationships in diverse settings. ● Applyconflictmanagementandgroupproblem-solvingstrategies. ● Demonstrate professional behavior in the classroom, lab, and clinical settings, including but not limited to appropriate personal hygiene, timeliness, preparation, and concentration. CommunicationSkills–verbal,non-verbal,andwritten ● ProcessandcommunicateinformationeffectivelyandpromptlyinEnglish. ● ComprehendwrittenmaterialinEnglishatalevelrequiredforsafeandeffectivepatientcare. ● Effectively communicate information in the English language in a concise yet comprehensive manner regarding the status and safety of patients, including written or dictated patient assessments. ● Effectively communicate with instructors, patients, families, and other healthcare providers in English. ● Recognize,interpret,andrespondtononverbalbehavior. ● Demonstratetheabilitytolisteneffectively. MotorSkills – gross motor, fine motor, coordination ● Abilitytositforlongperiods,includinguptofour(4)hours. ● Abilitytostandforlongperiods,includinguptosix(6)hours. ● Adjust and position patients and equipment, including bending or stooping to floor level and reaching above head height. ● Moveandposition patients and equipment, including lifting, carrying, pulling, and guiding weights upto50pounds(22.68kilograms). ● Assist in patient care, including standing, kneeling, sitting, or walking for 60 minutes or longer withoutrest. ● Demonstrateabilitytomanipulatephysicaltherapyequipment,includingfingerdexterity. ● PerformCPRwithoutassistance. SensorySkills – visual, auditory, tactile 66

● Ability to observe and respond to patient responses, including facial expressions, movement patterns, verbal responses, and reactions to the environment. ● Ability to assess safety factors involving patient care and physical environment and take measures necessary to assure a safe environment. ● Abilitytorespondtoequipmentalarms,callbells,andtimers. ● Abilitytoeffectively monitor blood pressure and breath sounds. ● Tactileability to palpate pulse and detect skin texture abnormalities, skin temperature, muscle tone, tissue texture, and joint movement. Associate of Science in Radiologic Technology Program (A.S. in RT) A.S. in RT students must have the following abilities: ● Liftmorethan50pounds(22.68kilograms). ● Beabletopushandpullroutinely. o One (1) pound (0.45 kilograms) – five (5) pounds (2.27 kilograms) frequently – image receptors, lead aprons. o 20pounds(9.07kilograms)–occasionally–patienttransfersandpositioning. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Mustbeabletomovequicklyonthefeet. ● Possessadequatevisualacuitytoreviewradiographsinvaryingbrightnesslevels. ● Standandwalkonyourfeet80%ofthetime. ● Reachatoraboveshoulderlevelfor90%ofworktime. ● Bendorflextheuppertrunkforwardto45degreesandthelowertorsointoasquattingposition. ● Rotatetheuppertrunkto30degreestotherightandleft. ● Workcompassionatelyandeffectivelywithsickpatients. A.S. in RT students must have sufficient strength, motor coordination, and manual dexterity to ● Transport, move, lift, and transfer patients from a wheelchair or cart to an x-ray table or a patient bed. ● Move, adjust, and manipulate various radiographic equipment, including portables and C-arm equipmenttransportation. ● Complete examinations on the patient according to established policies and procedures with speed andaccuracy. A.S. in RT students must also be capable of: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● Providingphysicalandemotionalsupporttothepatientduringtheradiographicprocedures. ● Ability to respond to situations requiring first aid and provide emergency care to the patient without or until the physician arrives. ● Communicatingverballyinaneffectivemannertodirectpatientsduringradiographicexaminations. ● Visuallyrecognizinganatomyonacomputermonitor. ● Readingandinterpretingpatientchartsandrequisitionsforradiographicexaminations. ● Respondtowarningsounds,machinealarms,andcallsforhelp. A.S. in RT students must have the mental and intellectual capacity to ● Calculate and select proper technical factors according to the individual needs of the patient and the requirementsoftheprocedure’sstandardsofspeedandaccuracy. ● Review and evaluate the recorded images on a computer monitor and archiving system for identifying patient pathology, if present, accurate positioning and technical factors for completion of adiagnostic examination, and other appropriate and pertinent technical qualities. 67

● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalsituations. ● Behave ethically, soundly, competently, compassionate, and professionally in the classroom and the clinic. BachelorofScienceinNursingProgram(BSN) Each program hasphysical and non-physical requirements to ensure students’ and patients’ safety and welfare. Almostall of our students (check with an Admission Advisor if applicable) must be able to: ● Handlestressfulsituationsrelatedtotechnicalandproceduralstandardsandpatientcaresituations. ● RespondquicklyandappropriatelytoemergenciesusingtheEnglishlanguage. ● CommunicateeffectivelywithpatientsandstaffinverbalandwrittenformsinclearEnglish. ● Readandinterpret(orlearnhowto)patientchartsandrequisitions. ● Toleratestrong,unpleasantodors. ● Providephysicalandemotionalsupporttothepatientsduringprocedures. ● Reportclearlyandlegiblythroughprogressnotesinpatientcharts. ● Meetclassstandardsforsuccessfulcoursecompletion. ● Collect,interpret, and integrate data about patients. ● Recognize and respond appropriately to individuals of all ages, genders, and races across socioeconomic, religious, and cultural backgrounds. ● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalconditions. ● Recognizeandrespondappropriatelytopotentiallyhazardoussituations. ● Demonstratethephysicalandemotionalcapacitytoworka40-hourweekontheclinicalrotation. ● Behave ethically, soundly, competently, compassionate, and professionally in the classroom and the clinic. ● Requiresintermittentsitting, standing, and walking up to eight (8) hours per day. ● Requiresbending, squatting,kneeling, twisting, and reaching. ● Requires frequentlifting and carrying 25 pounds (11.34 kilograms) – 50 pounds (22.68 kilograms). ● Requires pushingorpullingupto100pounds(45.36kilograms). ● Utilizethesenseofhearingtocommunicateeffectivelywiththepatientsandhealthcareteam. ● Utilize the sense of vision in all hospital lighting levels, varying from low illumination levels to bright light levels. ● Sitinclassforuptosixtoeight(6–8)hoursperday. ● Palpateanatomicalstructuresandhandleinjuredbodypartswithoutcausinginjurytothepatient. ● Duringexercise,givemanualresistancetoapatient’sarm,leg,ortrunk. ● Movewithadequateagilityandspeedtoensurepatientsafety. ● Walkandbalance well enough to help patients walk and transfer with or without equipment while preventing injury to patients and themselves. ● Safelygraspandmanipulatesmallobjectsandsetdialsonelectricalequipment. ● Usevisual,auditory,andtactilesensestoobservepatientsandcollectandinterpretdata. ● Respondtowarningsounds,machinealarms,andcallsforhelp. BachelorofScienceinRadiationTherapyProgram(B.S.inRT) B.S. in RT students must have the following abilities: ● Liftover50pounds(22.68kilograms). ● Beabletopushandpullroutinely. o 1-5lbs.frequently–leadaprons,files,leadsyringes. o 20-70lbs.occasionally–patienttransfersandpatientpositioning. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Mustbeabletomovequicklyonfoot. ● Sitinclassforuptoeight(8)hoursperday. 68

● Standandwalkonyourfeet80%ofthetime. ● Reachatoraboveshoulderlevelfor90%ofworktime. ● Bendorflextheuppertrunkforwardto45degreesandthelowertorsointoasquattingposition. ● Rotatetheuppertrunkto30degreestotherightandleft. ● Workcompassionatelyandeffectivelywithsickpatients. B.S. in RT students must have sufficient strength, motor coordination, and manual dexterity to ● Transport,lift, and transfer patients from a wheelchair or cart to a simulation, table, or patient bed. B.S. in RT students must also be capable of: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● Providingphysicalandemotionalsupporttothepatient. ● Ability to respond to situations requiring first aid and providing emergency care to the patient withoutoruntilthephysicianarrives. ● Communicatingverballyinaneffectivemannertodirectpatients. ● Visuallyrecognizinganatomyonacomputermonitor. ● Respondtowarningsounds,machinealarms,andcallsforhelp. B.S. in RT students must have the mental and intellectual capacity to ● Review and evaluate images on a computer monitor and archiving system to identify patient anatomyandpathology. ● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalsituations. ● Behave ethically, soundly, competently, compassionate, and professionally in the classroom and the clinic. BoneDensitometryTechnicianProgram(DXA) DXAstudentsmusthavethefollowingabilities: ● Liftmorethan50pounds(22.68kilograms). ● Beabletopushandpullroutinely. o One (1) pound (0.45 kilograms) – five (5) pounds (2.27 kilograms) frequently – image receptors, lead aprons. o 20pounds(9.07kilograms)–occasionally–patienttransfersandpositioning. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Mustbeabletomovequicklyonthefeet. ● Possessadequatevisualacuitytoreviewradiographsinvaryingbrightnesslevels. ● Standandwalkonyourfeet80%ofthetime. ● Reachatoraboveshoulderlevelfor90%ofworktime. ● Bendorflextheuppertrunkforwardto45degreesandthelowertorsointoasquattingposition. ● Rotatetheuppertrunkto30degreestotherightandleft. ● Workcompassionatelyandeffectivelywithsickpatients. DXAstudentsmusthavesufficientstrength,motorcoordination,andmanualdexterityto ● Transport, move, lift, and transfer patients from a wheelchair or cart to an x-ray table or a patient bed. ● Move,adjust,andmanipulatevariousmobileandnon-mobilenuclearmedicineequipment. ● Complete examinations on the patient according to established policies and procedures with speed andaccuracy. 69

DXA studentsmustalsobecapableof: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● Providingphysicalandemotionalsupporttothepatientduringtheradiographicprocedures. ● Ability to respond to situations requiring first aid and provide emergency care to the patient without or until the physician arrives. ● Communicatingverballyinaneffectivemannertodirectpatientsduringradiographicexaminations. ● Visuallyrecognizinganatomyonacomputermonitor. ● Readingandinterpretingpatientchartsandrequisitionsforradiographicexaminations. ● Respondtowarningsounds,machinealarms,andcallsforhelp. DXA studentsmusthavethementalandintellectualcapacityto ● Calculate and select proper technical factors according to the individual needs of the patient and the requirementsoftheprocedure’sstandardsofspeedandaccuracy. ● Review and evaluate the recorded images on a computer monitor and archiving system for identifying patient pathology, if present, accurate positioning and technical factors for completion of adiagnostic examination, and other appropriate and pertinent technical qualities. ● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalsituations. ● Behaveethically,soundly,competently,compassionate,andprofessionallyintheclassroom. MedicalAssistantProgram(MA) Each program hasphysical and non-physical requirements to ensure students’ and patients’ safety and welfare. Almostall of our students (check with an Admission Advisor if applicable) must be able to: ● Handlestressfulsituationsrelatedtotechnicalandproceduralstandardsandpatientcaresituations. ● RespondquicklyandappropriatelytoemergenciesusingtheEnglishlanguage. ● CommunicateeffectivelywithpatientsandstaffinverbalandwrittenformsinclearEnglish. ● Readandinterpret(orlearnhowto)patientchartsandrequisitions. ● Toleratestrong,unpleasantodors. ● Providephysicalandemotionalsupporttothepatientsduringprocedures. ● Reportclearlyandlegiblythroughprogressnotesinpatientcharts. ● Meetclassstandardsforsuccessfulcoursecompletion. ● Collect,interpret, and integrate data about patients. ● Recognize and respond appropriately to individuals of all ages, genders, and races across socioeconomic, religious, and cultural backgrounds. ● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalconditions. ● Recognizeandrespondappropriatelytopotentiallyhazardoussituations. ● Demonstratethephysicalandemotionalcapacitytoworka40-hourweekontheclinicalrotation. ● Behave ethically, soundly, competently, compassionately, and professionally in the classroom and theclinic. ● Lift/carry: ○ One (1) pound (0.45 kilograms) – five (5) pounds (2.27 kilograms) frequently – image receptors, lead aprons, files. ○ 20 pounds (9.07 kilograms) – 50 pounds (22.68 kilograms) occasionally – patient transfers andpositioning. ○ 50 pounds (22.68 kilograms) – 70 pounds (31.75 kilograms) rarely to occasionally – patient transfers. ● Standandwalkforupto8hoursperday. ● Carryaminimumof20pounds(9.07kilograms)whilewalkingadistanceof100feet(30.48m). ● Bendorflextheuppertrunkforwardto45degreesandthelowertorsointoasquattingposition. ● Rotatetheuppertrunkto30degreestotherightandleft. 70

● Reachatleast72inches(1.83m)abovefloorlevelorafullarm’sreach. ● Utilizethesenseofhearingtocommunicateeffectivelywiththepatientsandhealthcareteam. ● Utilizethesenseofvisioninalllightinglevels, varying from low illumination to bright light levels. ● Sitinclassforuptosix(6)hoursperday. ● Palpateanatomicalstructuresandhandleinjuredbodypartswithoutcausinginjurytothepatient. ● Duringexercise,givemanualresistancetoapatient’sarm,leg,ortrunk. ● Movewithadequateagilityandspeedtoensurepatientsafety. ● Walkandbalance well enough to help patients walk and transfer with or without equipment while preventing injury to patients and themselves. ● Safelygraspandmanipulatesmallobjectsandsetdialsonelectricalequipment. ● Usevisual,auditory,andtactilesensestoobservepatientsandcollectandinterpretdata. ● Respondtowarningsounds,machinealarms,andcallsforhelp. X-RayTechnicianwithMedicalAssistantSkillsProgram(XTMAS) XTMASstudentsmustbehealthyandhavethefollowingabilities: ● Liftmorethan50pounds(22.68kilograms). ● Beabletopushandpullroutinely. o One (1) pound (0.45 kilograms) – five (5) pounds (2.27 kilograms) frequently – image receptors, lead aprons. o 20pounds(9.07 kilograms) – 70 pounds (31.75 kilograms) occasionally – patient transfers andpositioning. ● Hearsufficientlytoassesspatientneedsandcommunicateverballywithotherhealthcareproviders. ● Havefulluseofarms,hands,andwrists. ● Mustbeabletomovequicklyonthefeet. ● Possessadequatevisualacuitytoreviewradiographsinvaryingbrightnesslevels. ● Standandwalkonyourfeet80%ofthetime. ● Reachatoraboveshoulderlevelfor90%ofworktime. ● Bendorflextheuppertrunkforwardto45degreesandthelowertorsointoasquattingposition. ● Rotatetheuppertrunkto30degreestotherightandleft. ● Workcompassionatelyandeffectivelywithsickpatients. XTMASstudentsmusthavesufficientstrength,motorcoordination,andmanualdexterityto ● Transport, move, lift, and transfer patients from a wheelchair or cart to an x-ray table or a patient bed. ● Move,adjust,andmanipulatevariousradiographicequipmentforphysicaltransportation. ● Complete examinations on the patient according to established policies and procedures with speed andaccuracy. XTMASstudentsmustalsobecapableofthefollowing: ● Handling stressful situations related to technical and procedural standards and patient care situations. ● Providingphysicalandemotionalsupporttothepatientduringtheradiographicprocedures. ● Ability to respond to situations requiring first aid and provide emergency care to the patient without or until the physician arrives. ● Communicatingverballyinaneffectivemannertodirectpatientsduringradiographicexaminations. ● Visuallyrecognizinganatomyonacomputermonitor. ● Readingandinterpretingpatientchartsandrequisitionsforradiographicexaminations. ● Respondtowarningsounds,machinealarms,andcallsforhelp. XTMASstudentsmusthavethementalandintellectualcapacityto 71

● Calculate and select proper technical factors according to the individual needs of the patient and the requirementsoftheprocedure’sstandardsofspeedandaccuracy. ● Review and evaluate the recorded images on a computer monitor and archiving system for identifying patient pathology, if present, accurate positioning and technical factors for completion of adiagnostic examination, and other appropriate and pertinent technical qualities. ● Copewithheavyworkloads,demandingpatients,andlife-threateningclinicalsituations. ● Behave ethically, soundly, competently compassionate, and professionally in the classroom and the clinic. RE-ENROLLMENT Individuals may not always be eligible to re-enroll at Gurnick Academy of Medical Arts. The situations detailed belowoutlinethecircumstanceswherere-enrollmentmayormaynotbepermissible. Expulsion Students can be expelled involuntarily by Gurnick Academy of Medical Arts for two main reasons: academic anddisciplinary. AcademicExpulsion Individuals expelled for academic reasons can be re-enrolled into the same program one (1) time and are not eligible for remediation. A re-enrolled student (previously expelled for academic reasons) is placed on academic probationary status and is not eligible for remediation. Students who failed VN 440 may still be eligible for graduation. Please see the VN Program-Specific Placement & Credit Granting section. The academic probationary status is lifted once the student graduates from the program. Re-enrolled students with academic probationary status are not eligible for financial aid until they successfully pass the course they are repeating with a grade of ’C’ or higher. Once the student passes the course with a letter of ’C’ or higher, the student maybeeligible to receive Financial Aid. Students expelled for cheating must complete an additional online ethics course before being eligible for re-enrollment. Individuals expelled for a second time are not permitted to re-enroll. Disciplinary Expulsion Individuals expelled for disciplinary reasons are not permitted to re-enroll in the same program and may not be eligible for enrollment at Gurnick Academy of Medical Arts. Please read Disciplinary Probation for details. Withdrawal Students may withdraw voluntarily. Students may voluntarily withdraw up to two (2) times to re-enroll. Individuals who withdraw more than two (2) times voluntarily may not re-enroll. FOREIGNTRANSCRIPT/DIPLOMAEVALUATIONS All foreign transcripts and degrees must be evaluated and translated into equivalent college hours by a “Foreign education transcript evaluation organization” to be accepted by Gurnick Academy of Medical Arts. Some affiliated institutions of your program, such as certification and licensure bodies, may require a specific provider to evaluate your foreign degree/diploma. The student must check with the program’s 72

certification/licensure bodies if the latter accepts your chosen foreign degree/diploma evaluator. Please see below some of our programs’ requirements: ● VNApplicantswithaForeignHighSchoolEducationLevel: Applicants to the Vocational Nurse Program must submit a copy of their original foreign high school diploma or original foreign transcript upon admission into either program in addition to their foreign transcript/diploma evaluation. ● ImagingApplicants: ARRT® (Registry for Associate of Science in MRI, Associate of Science in Radiologic, Associate of Occupational Science in Radiologic, and Associate of Occupational Science in Ultrasound Technologists) recognizes services of evaluators such as NACES and AICE. Please check with the ARRT®beforegoingfurtherwiththeevaluation. ● LVN-BSNandRN-BSNApplicants: Applicants who need to meetthecourseequivalencyadmissionrequirementmustsubmitacopyof their original foreign degree and a copy of their original foreign degree transcript (in addition to their foreign transcript/degree evaluation) before admission into the program. Following is a compilation of possible foreign education transcript evaluation organizations. Gurnick Academy of Medical Arts does not review nor endorse these (or other) providers of foreign education transcription; however, Gurnick Academy of Medical Arts accepts their evaluations. ● NationalAssociationofCredentialEvaluationServices(NACES):https://www.naces.org/ ● AssociationofInternationalCredentialEvaluators (AICE): http://aice-eval.org/ ● a2zEvaluations,LLC:https://www.a2zeval.com/ ● AcademicEvaluationServices,Inc.:https://aes-edu.org/ ● CenterforAppliedResearch,Evaluation,andEducation,Inc:https://www.iescaree.com/ ● EducationalCredentialEvaluators,Inc.: https://www.ece.org/ ● EducationalPerspectives,nfp:https://www.edperspective.org/ ● EducationalRecordsEvaluationService,Inc.:http://www.eres.com/ ● EvaluationService,Inc.: http://www.evaluationservice.net/ ● ForeignAcademicCredentialService,Inc.:https://facsusa.com/ ● FoundationforInternationalServices,Inc.: https://www.fis-web.com/ ● GlobalCredentialEvaluators,Inc.: https://gceus.com/ ● GlobalServicesAssociates,Inc.: http://www.globaleval.org/ ● InternationalAcademicCredentialEvaluators,Inc.: https://www.iacei.net/ ● International Consultants of Delaware, Inc.: https://www.icdeval.com/ ● International Education Evaluations, Inc.: https://www.myiee.org/ ● International Education Research Foundation, Inc.: https://ierf.org/ ● Josef Silny and Associates, Inc. International Education Consultants: https://www.jsilny.org/ ● SpanTran: The Evaluation Company: https://spantran.com/ ● TranscriptResearch:https://transcriptresearch.com/ ● WorldEducationServices,Inc.:https://www.wes.org/ IMMUNIZATIONREQUIREMENTS Gurnick Academy of Medical Arts requires all students to be immunized appropriately for protection and compliance with state regulations. Documentation of immunizations must be provided to the admissions office before starting the program or clinical rotations as programmatically determined. Students must comply with the minimum health requirements from each clinical facility when performing clinical rotations, which may include additional immunity or vaccination requirements not explicitly listed within this catalog. The student will pay the cost of the immunizations. Students must show proof of the 73

following immunities and vaccinations (immunization documents or evidence of a blood titer) before the clinical component can be attended: ● Varicellaimmunity ● MMRimmunity ● Up-to-datetetanusshots(definedaswithinthepastten[10]years) ● Hepatitis B vaccine series (If incomplete, proof of immunization must be shown for the second shot within one [1] month from the first shot and the third shot within six [6] months from the first shot). ● Two-step tuberculin test within the past six (6) months (In case of a positive TB test result, the student musthaveproofofanegativechestx-raywithintwo[2]years.Studentsmaybeexpectedto complywithadditionalTBscreeningrequirementsdeterminedbythehospital/clinicalsetting). ● COVID-19vaccination(basedonafulldoseasdefinedbyCDCguidelines) Failure to keep these immunization requirements current could impact the student’s ability to attend the clinical facility, complete the program’s graduation requirements, or obtain certification after completion. Gurnick Academy of Medical Arts reserves the right not to accept titers if they are not done within the last three (3) years. HEALTHSCREENINGREQUIREMENTS Each applicant must provide an attestation from their family physician certifying the absence of physical, mental, and contagious disorders. Drug screening test results are required before starting clinical rotations and must be completed at a laboratory chosen by Gurnick Academy of Medical Arts. Positive results of a student’s drug testing could impact the student’s ability to attend the clinical facility, complete the program’s graduation requirements, or obtain certification/licensure after completing the program. The student will pay the cost of examinations, screenings, and drug tests; for exceptions and approximate services costs, please check the Addendum,CurrentFees,andTuitionsection. BACKGROUNDCHECK Applicants may need a general background check before starting the clinical rotation, as requested by a hospital/clinical setting. For some of our programs, background checks are a mandatory requirement. Please check the Addendum, Current Fees, and Tuition section for service costs. Gurnick Academy of Medical Arts will facilitate background check procedures. The student will provide background check results to the clinical facility upon request of the clinical education site. Background check results could impact the student’s ability to attend the clinical facility, complete the program’s graduation requirements, or obtain certification/licensure after completing the program. Applicants should know that the clinical education site can request an additional background check or refuse a student based ontheresults. Applicants should check State regulations related to criminal convictions and the ability to belicensed. CPR Before starting any program or its clinical rotation component, students must submit proof of completion and current certification in CPR for Basic Life Support. Failure to keep this certification current could impact the 74

student’s ability to attend the clinical facility, complete the program’s graduation requirements, or obtain certification after completion. CLINICALFACILITIES Gurnick Academy of Medical Arts has entered into affiliation agreements with clinical facilities that provide students with experiences in many areas following program requirements. Students are assigned to clinical experiences in hospitals and various outpatient centers in the community. Clinical site availability varies and is closely managed by the Program Coordinators and Outreach Department to provide students with experiences to meet each discipline requirement. The clinical experiences help students gain experience that prepares them for entry-level positions in the medical field. In cases of incidents/accidents occurring on the premises of Clinical Sites, please see our Safety Policy. For a complete list of Gurnick Academy of Medical Arts’ clinical facilities, please contact the program’s AdmissionAdvisororProgramDirector/Coordinator. TRAVELDISCLOSURE Every attempt is made to place a student as close to home as possible. However, clinical experiences are often limited by the number of students living within a specific geographic region and the number of clinical sites available. In addition, students may be required to rotate between clinical sites during their clinical education to ensure all students receive equitable, high-quality clinical education during their training. All students must be prepared and willing to commit to any travel time required to achieve the program’s educational goals. Students may be required to travel more than an hour to clinical sites. Travel to a clinical site varies and can be over 100 miles (160.93 km) one way from campus. In addition, some of our programs may occasionally conduct labs at our clinical sites. Students/applicants are encouraged to check with their program officials for more details. Rotation requirements will be presented to thestudentsbytheirrespectiveClinical Coordinators or Program Directors. Gurnick Academy of MedicalArtsdoesnotprovidetransportationforstudentstoclinicalsites. Students should plan accordingly for additional travel costs. The student must have a reliable means of transportation. The student is responsible for acquiring an alternative form of transportation if the student does not have access to a vehicle for personal use or does not have a valid driver’s license. Each student needs to have independent, reliable transportation. Clinical assignments cannot and will not be based on transportation needs. ADVANCEDPLACEMENT&CREDITGRANTING There is no charge for the review of transfer credit or experiential learning. Students will receive a written evaluation of credits, either accepted or denied. Credit granting is only available before enrollment. Credit granting will not be evaluated once a student is enrolled. All decisions on transfer credit or experiential learning are final; appeals are not accepted. Students can be granted credit up to 49% of the total hours in certificate and diploma programs and up to 75% of the total hours in degree programs. Credit Granting will be awarded according to program, state, and academy policies. Transfer credits for General Education courses may be granted regardless of when they are completed. Transfer credit towards a certain program, experiential learning, challenge examinations, and 75

achievement tests may be given for previous related education if the credits were granted within the last five (5) years from an institution accredited by an agency that is recognized by the United States Department of Education (U.S.DOE) or the Council for Higher Education Accreditation (CHEA) and the student received a course grade of ’C’ or higher. ProgramSpecificPlacement&CreditGranting Associate of Occupational Science in Cardiac Ultrasound Technology Program (A.O.S. in CUT) Credits earned from courses or programs approved by: 1. Joint Review CommitteeonEducationinDiagnosticMedicalSonographyaccreditedultrasoundcourses andprograms. 2. Competency-based credit is granted for knowledge and skills acquired through experience. Written andpractical examinations will determine credit. 3. Exceptions may be madeforcredits granted over five (5) years for General Education courses. Associate of Occupational Science in Respiratory Care Program (A.O.S. in RC) Credits earned from courses or programs approved by: 1. CommissiononAccreditationforRespiratoryCare(CoARC). 2. Other courses the institution determines are equivalent to courses within the Associate of Occupational Science in Respiratory Care program curriculum. 3. Competency-based credit is granted for knowledge and skills acquired through experience. Written and practical examinations will determine credit. Thestudentmustsubmitthefollowingrequireddocuments: · Original transcript · Coursedescription (can be downloaded from the school’s catalog/website) · Completed Credit Granting Disclosure and Transfer Credit Request Form accurately and within thespecified deadline. Associate of Occupational Science in Radiologic Technology Program (A.O.S. in RT) Credits earned from courses or programs approved by: 1. California Department of Public Health, Radiologic Health Branch accredited radiologic technology courses and programs. 2. Joint Review Committee on Education in Radiologic Technology accredited radiologic technology courses and programs. 3. Other courses the institution determines are equivalent to courses within the Associate of Science in Radiologic Technology program curriculum. 4. Exceptions may be madeforcredits granted over five (5) years for General Education courses. 5. Coursesspecific to radiography will not be credit granted if they are older than three (3) years. Associate of Occupational Science in Ultrasound Technology Program (A.O.S. in UT) Credits earned from courses or programs approved by: 1. Joint Review Committee on Education in Diagnostic Medical Sonography accredited ultrasound courses and programs. 2. Competency-based credit is granted for knowledge and skills acquired through experience. Written andpractical examinations will determine credit. 3. Exceptions may be madeforcredits granted over five (5) years for General Education courses. Associate of Occupational Science in Vascular Ultrasound Technology Program (A.O.S. in VUT) Credits earned from courses or programs approved by: 4. Joint Review CommitteeonEducationinDiagnosticMedicalSonographyaccreditedultrasoundcourses 76

andprograms. 5. Competency-based credit is granted for knowledge and skills acquired through experience. Written andpractical examinations will determine credit. 6. Exceptions may be madeforcredits granted over five (5) years for General Education courses. Associate of Science in Magnetic Resonance Imaging Program (A.S. in MRI) Credits earned from courses or programs approved by: 1. Joint Review Committee on Education in Radiologic Technology accredited magnetic resonance imagingtechnologycoursesandprograms. 2. Competency-based credit is granted for knowledge and skills acquired through experience. Written andpractical examinations will determine credit. 3. Exceptions may be madeforcredits granted over five (5) years of General Education courses. Associate of Science in Nursing Program (ADN) Credits earned from courses or programs accredited by an agency recognized by the United States Department of Education (U.S.DOE) or the Council for Higher Education Accreditation (CHEA): 1. Licensed Vocational Nursing Courses (22 Semester Credit Hours) 2. Othercoursestheschooldeterminesareequivalenttocoursesintheprogram. In compliance with the California Board of Registered Nursing (BRN), military education and experience credit is available at Gurnick Academy of Medical Arts. Individuals who have held Military Healthcare Occupations, specifically Basic Medical Technician Corpsman (Navy HM or Air Force BMTCP), Army Healthcare Specialist (68W Army Medic), or Air Force Independent Duty Medical Technician (IMDT 4NOX1C) may achieve advanced placement into the Associate of Science in Nursing program upon review and approval from the Program Director. Submit documentation of education and experience to qualify them for the specific Military Health Care Occupation, and upon successful completion of the challenge exam, dosage calculation exam, and skills competencyevaluation. ● Applicants must meet all Associate Degree Nursing Program admission requirements and complete the designated prerequisites and the current Test of Essential Academic Skills (TEAS) with a minimum score of 64% and a minimumGPAof2.5. ● Applicantsmustsubmitproofofhonorabledischargefromthemilitaryandproofofmilitaryservice. ● Acceptance into the Associate Degree Nursing Program is based upon space availability, military education, experience eligibility, and a minimum passing score of 90% on the Challenge Exam and 86%onadosagecalculationexam. An admission course is required for all students electing to enroll in the LVN Advanced Placement Pathways for the ADN andBSNprograms.TheRN180NursingTransitionAdvancedPlacementTheory&Labistheadmission course. It is a five (5) unit, 120-hour course that evaluates the student’s readiness to be eligible for enrollment into the Advanced Placement pathway. The student must demonstrate the required knowledge and skills to completethiscourse. All students must complete the RN 180 course before starting any Professional Courses. Students enrolled in the RN 180 are eligible to challenge the OB and Pediatrics courses. Students must contact the Assistant Director to request the challenge exams. The OB and Pediatrics theory courses are paired with a corresponding clinical course. Failure in one course equals failure in the paired course. Students must pass the challenge exams before scheduling the competency exams. The minimum passing score for the challenge exam is 90%, and the minimum passing score for the competency exam is 90%. If the above requirementsareunmet,thestudentwillcompletetherequiredcoursesasscheduled. 77

Students who fail RN 402 may submit proof of passing the NCLEX-RN exam to obtain credit for RN 402 and graduate from the ADN Program. All other graduation requirements (i.e., zero account balance) must also be met. Associate of Science in Physical Therapist Assistant Program (A.S. in PTA) Credits earned from courses or programs approved by: 1. Credits earned from courses or programs accredited by CAPTE. 2. Credits earned at institutions with regional or national accreditation. 3. per Associate of Science in Radiologic Technology Program (A.S. in RT) Credits earned from courses or programs approved by: 1. California Department of Public Health, Radiologic Health Branch accredited radiologic technology courses and programs. 2. Joint Review Committee on Education in Radiologic Technology accredited radiologic technology courses and programs. 3. Other courses the institution determines are equivalent to courses within the Associate of Science in Radiologic Technology program curriculum. 4. Exceptions may be madeforcredits granted over five (5) years for General Education courses. 5. Coursesspecific to radiography will not be credit granted if they are older than three (3) years. BachelorofScienceinDiagnosticMedicalImaging(B.S.inDMI) Credits earned from courses or programs accredited by an agency recognized by the United States Department of Education (U.S.DOE) or the Council for Higher Education Accreditation (CHEA). BachelorofScienceinNursingProgram(BSN) Credits earned from courses or programs accredited by an agency recognized by the United States Department of Education (U.S.DOE) or the Council for Higher Education Accreditation (CHEA): 1. Registered nursing courses. 2. ArmedServicesnursingcourses. 3. Othercoursestheschooldeterminesareequivalenttocoursesintheprogram. 4. Exceptions may be madeforcredits granted over five (5) years for General Education courses. Competency-based credit is granted for knowledge and skills acquired through experience. Written and practical examinations will determine credit. In compliance with the California Board of Registered Nursing (BRN), military education and experience credit is available at Gurnick Academy of Medical Arts. Individuals who have held Military Healthcare Occupations, specifically Basic Medical Technician Corpsman (Navy HM or Air Force BMTCP), Army Healthcare Specialist (68W Army Medic), or Air Force Independent Duty Medical Technician (IMDT 4NOX1C) may achieve advanced placement into the Bachelor of Science in Nursing program upon review and approval from the Program Director. Submit documentation of education and experience that qualifies them for the specific Military Healthcare Occupation upon completing the challenge exam, dosage calculation exam, and skills competency evaluation. ● Applicants must meet all Bachelor Degree Nursing Program admission requirements and complete designated prerequisites and the current Test of Essential Academic Skills (TEAS) with a minimum score of 64% and a minimumGPAof2.5. ● Applicants must submit proof of honorable discharge from the military and proof of military service within the last five (5) years. 78

● Acceptance into theBachelorofScienceinNursing Programisbaseduponspaceavailability,military education, experience eligibility, and a minimum passing score of 75% on the Challenge Exam and 100%onadosagecalculationexam. An admission course is required for all students electing to enroll in the LVN Advanced Placement Pathways for the ADN andBSNprograms.TheRN180NursingTransitionAdvancedPlacementTheory&Labistheadmission course. It is a five (5) unit, 120-hour course that evaluates the student’s readiness to be eligible for enrollment into the Advanced Placement pathway. The student must demonstrate the required knowledge and skills to complete this course. All students must complete the RN 180 course before starting any Professional Courses. Students enrolled in the RN 180 are eligible to challenge the OB and Pediatrics courses. Students must contact the Assistant Director to request the challenge exams. The OB and Pediatrics theory courses are paired with a corresponding clinical course. Failure in one course equals failure in the paired course. Students must pass the challenge exams before scheduling the competency exams. The minimum passing score for the challenge exam is 90%, and the minimum passing score for the competency exam is 90%. If the above requirementsaremet,thestudentwillcompletetherequiredcoursesasscheduled. Students who fail RN 505 may submit proof of passing the NCLEX-RN exam to obtain credit for RN 505 and graduate from the BSN Program. All other graduation requirements (i.e., zero account balance) must also be met. Vocational Nurse (VN) Program Credits earned from courses or programs accredited by an agency recognized by the United States Department of Education (U.S.DOE) or the Council for Higher Education Accreditation (CHEA): 1. Vocational or practical nursing courses. 2. Registered nursing courses. 3. Psychiatric courses. 4. ArmedServicesnursingcourses. 5. Certified nurse assistant courses. 6. Othercoursestheschooldeterminesareequivalenttocoursesintheprogram. 7. Competency-based credit is granted for knowledge and skills acquired through experience. Written andpractical examinations will determine credit. Students who fail VN440 may submit proof of passing the NCLEX-PN exam to obtain credit for VN440 and graduate from the VN Program. All other graduation requirements (i.e., zero account balance) must also be met. LICENSURE,CERTIFICATION,®ISTRYDISCLAIMER Graduates from this institution’s programs may seek additional credentials after completing their program of study. While voluntary, additional credentials do enhance employment opportunities and potential income. Certifications are available for all the institution’s programs. Certificates and licenses are available and voluntary for all programs offered except for the following: ● Associate of Science in Physical Therapist Assistant program ● Associate of Science in Nuclear Medicine Technology program ● Associate of Science in Nursing program ● Associate of Science in Respiratory Care program ● Associate of Science in Radiologic Technology program 79

● Associate of Occupational Science in Radiologic Technology program ● Bachelor of Science in Nursing program ● Bachelor of Science in Radiation Therapy program ● BoneDensitometryTechnicianprogram ● Vocational Nurse program ● X-ray Technician with Medical Assistant Skills program TheprogramslistedabovealsorequirelicensureforpracticeinCalifornia. Outside agencies control licensing examinations and their content. Gurnick Academy of Medical Arts cannot guarantee the outcome of licensing examinations. Registration or license requirements for taking and passing theexaminationarenotcontrolledbytheinstitutionbutbyoutsideagenciesorlicensingboards. Requirements are subject to change by the agency without notice to Gurnick Academy of Medical Arts. Therefore, the institution cannot guarantee that graduates will be eligible to take licensing certification exams at all or any specific time, regardless of their eligibility status upon enrollment. Often, the eligibility of program graduates is impacted by the specific programmatic accreditation of the institution’s programs. Several of the institution’s programs possess appropriate programmatic accreditations that meet certifying agency educational requirements. Please refer to the individual program listings in this catalog to determine the programmatic accreditation standing of a specific program. State Authorization Gurnick Academy of Medical Arts has not determined if any programs fulfill the educational requirements for specific professional licensure or certification required for employment outside California unless identified by the program below. It is recommended that students who are in or plan to relocate to a state apart from where the physical campus offering the program is located research any certification or employment requirements for their intended state. Gurnick Academy of Medical Arts can enroll students in distance education in the states below, adhering to eachstate’s requirements: •Arizona: The academy has identified non-regulation from licensure due to the absence of physical presence from the Arizona State Board for Private Postsecondary Education for the Associate of Science in MRI program. •Nevada: The academy has obtained approval from the Nevada Commission on Postsecondary Education to offer the Associate of Science in MRI program. •Florida: The academy has been notified of non-regulation from licensure due to lack of physical presence from the Florida Commission for Independent Education for the Associate of Science in MRI program. ProgramsSpecificLicensure, Certification & Registry Disclaimer Associate of Occupational Science in Cardiac Ultrasound Technology Program (A.O.S. in CUT) The law does not require Ultrasonographers to be registered by The American Registry of Diagnostic Medical Sonographers (ARDMS) or Cardiovascular Credentialing International CCI to work, but such credentials may increase hiring chances. Graduates who were accepted to the program with an Associate of Science degree in an Allied Health field directed at human patient care or a Bachelor of Science or Bachelor of Arts degree are eligible to sit for the ARDMSexamination immediately after completion of the program under ARDMSprerequisite1(forAssociate 80

of Science degree in an Allied Health field graduates) and ARDMS prerequisite 3A (for Bachelor of Science or Bachelor of Arts degree graduates) or for the CCI examination. Graduates accepted to the program with an Associate Degree in any field or High School Diploma / GED are eligible to sit for the CCI (RCS) examination immediately after completing the program. Upon obtaining CCI (RCS) certification, graduates may sit for the ARDMS (RDCS) examination under ARDMS prerequisite 5. For more information about the ARDMS registry and examination, you can visit www.ardms.org or contact them at The American Registry of Diagnostic Medical Sonographers, 51 Monroe Street, Plaza East One, Rockville, MD 20850, Telephone: (301) 738-8401 / Toll-Free: (800) 541-9754, Fax: (301) 738-0312 / 0313. For more information about CCI certification and examination, visit https://cci-online.org/ or contact them at Cardiovascular Credentialing International, 3739 National Drive, Suite 202, Raleigh, NC, 27612, (919)861-4539. Associate of Occupational Science in Respiratory Care Program (A.O.S. in RC) The Respiratory Care Board of California (RCB) is a state licensing agency with regulatory jurisdiction over respiratory care practitioners. The RCB’s mission is to protect and serve consumers by licensing qualified respiratory care practitioners, enforcing the provisions of the Respiratory Care Practice Act, expanding the availability of respiratory care services, increasing public awareness of the profession, and supporting the developmentandeducationofrespiratorycarepractitioners. According to the RCB, “To obtain licensure as an RCP in California, you must first obtain a Registered Respiratory Therapist (RRT) credential from the National Board for Respiratory Care (NBRC). To obtain an RRT credential, you must successfully pass the Therapist Multiple-Choice Examination (TMC) at the cut-off level required to qualify for the Clinical Simulation Examination (CSE) AND the Clinical Simulation Examination. Once you have completed your accredited respiratory care education program, you may apply for examination directly through the NBRC. The first examination you must take is the TMC Examination. There are two established cut scores for the TMC Examination. You will earn your CRT credential if you achieve the lower cut score. However, achieving the higher cut score will earn your CRT credential AND become eligible for the CSE. Once you have passed both the TMC andtheCSE,youwillearntheRRTcredentialandsatisfytheexamination requirement for licensure. If you have a California address, the RCB will obtain your examination results directly fromtheNBRC.” Graduates of the A.O.S. in RC program may sit for examinations set forth by the National Board for Respiratory Care. A prior criminal history does not preclude you from obtaining a license from the RCB. Each applicant for licensure must submit their fingerprints to the California Department of Justice and Federal Bureau of Investigation for a criminal history background check. Upon notification of an applicant’s criminal history, if any, theRCBwillopenaninvestigationtodeterminewhetherthereisabasistodenytheapplicationforlicensure. Effective July 1, 2020, the RCB’s authority to deny an application based on certain criminal convictions was restricted (Business and Professions Code section 480). Specifically, the RCB cannot deny an application based on a conviction if: · The conviction has been dismissed under Penal Code Sections 1203.4, 1203.4a, 1203.41, 1203.42, or 1203.425 (or another state’s equivalent). You may be asked to provide proof of this. · The conviction(s) occurred more than seven years from the date of the application, or if the 81

applicant was convicted of a crime and incarcerated, more than seven (7) years from when the applicant was released from incarceration. The National Board for Respiratory Care provides the testing needed to become registered, significantly improving employment opportunities. “The RRT credential is nationally recognized as the “standard of excellence” for respiratory care professionals. The examinations for the RRT credential objectively and uniformly measureessential knowledge, skills, and abilities required of advanced respiratory therapists. The NBRC evaluates the competency of respiratory therapists and ensures that graduates of accredited respiratory care education programs have every opportunity to earn the RRT credential. It is in high demand nationwide, and we work diligently to help fill the shortage of qualified respiratory therapists. The CRT and/or RRT credentials are used as the basis for the licensure in all 49 states that regulate the practice of respiratory care.” For more information about the RCP license process, please visit www.rcb.ca.gov/ or write to the Respiratory Care Board of California 3750 Rosin Court, Suite 100 Sacramento, CA 95834 Toll Free: (866) 375-0386 Phone: (916) 999-2190 Fax: (916) 263-7311 Email:[email protected]. For more information about RRT/CRT Credential, visit www.nbrc.org/ or contact the National Board for Respiratory Care 10801 Mastin St #300, Overland Park, KS 66210 (913) 895-4900. Associate of Occupational Science in Radiologic Technology Program (A.O.S. in RT) In the State of California, all schools of Radiologic Technology must receive approval from the State of California Department of Public Health Radiologic Health Branch before students can begin a course of instruction. The Associate of Science in Radiologic Technology program at Gurnick Academy of Medical Arts has obtained status as an approved school compliant with the radiographer instructional practices defined by California law. This school approval allows program graduates to take the radiographer certification examination offered by the State of California Department of Public Health. Once certified, the radiographer is legally allowed to practice within California. Eligibility for ARRT® Certification Per ARRT®´s “Equation for Excellence,” candidates for ARRT® certification must meet basic requirements in the three componentsoftheequation: 1. Ethics ARRTPre-ApplicationReviewProcess The American Registry of Radiologic Technology requires an applicant for the certifying exam to disclose any history of criminal and misdemeanor proceedings. The specific language is whether you havebeenconvictedofacrimeormisdemeanor,including,butnotlimitedto, 1. Misdemeanor 2. GrossMisdemeanor 3. Felony 4. All alcohol and drug-related violations 5. Military Court Martial For this section, “Convicted” includes a criminal proceeding where a finding or verdict of guilty is madeorreturned,but 1. Theadjudication of guilt is either withheld, deferred, or not entered; or 2. Thesentenceissuspendedorstayed,or 3. A criminal proceeding where the individual enters a plea of guilty or no contest (nolo contendere) or 4. Thereisapre-trial diversion. 82

You are NOT required to report offenses committed as a juvenile and were adjudicated through the juvenile court system. An applicant with a concern is advised to obtain a pre-application review of eligibility for certification before entering the program. The information can be obtained from the ARRT® by calling (651) 687-0048 or their website at https://www.arrt.org/. 2. Education Eligibility for certification also specifies the satisfaction of educational preparation requirements. For the primary pathway to certification, eligibility requires completing the formal educational program accredited by a mechanism acceptable to ARRT®. Candidates must also demonstrate competencyindidacticcourseworkandanARRT®-specifiedlistofclinicalprocedures. For a post-primary pathway to certification, candidates must hold registration in a supporting category and document ARRT®-specified clinical experience. Further details may be found in the handbooksavailableforeachpost-primarycertification discipline. 3. Examination Finally, eligibility requires candidates for certification, after having met all other qualifications, to pass an examination developed and administered by the ARRT®. The exams assess the knowledge and cognitive skills underlying the intelligent performance of the tasks typically required of staff radiologic therapeutic technologists practicing within the respective disciplines. Exam content is specified on this website and in the respective handbook for each discipline. California Department of Public Health, Radiologic Health Branch contact information is MS 7610, P.O. Box 997414, Certification Unit, Sacramento, CA 95899-7414, Phone: (916) 327-5106, Fax: (916) 440-7999, Web: https://www.cdph.ca.gov/Programs/CEH/DRSEM/Pages/RHB-Contact.aspx. The law requires that radiologic technologists be licensed to practice as radiographers. Completing the Associate of Science in Radiologic Technology program at Gurnick Academy of Medical Arts may not automatically qualify the graduate to apply for the ARRT® examination. Some employers might require the radiologic technologist to have an ARRT® certification in addition to the State of California certification. Associate of Occupational Science in Ultrasound Technology Program (A.O.S. in UT) The law does not require Ultrasonographers to be registered by The American Registry of Diagnostic Medical Sonographers(ARDMS)towork.However,suchcredentialsmayincreasehiringchances. Graduates who were accepted to the program with an Associate of Science degree in an Allied Health field directed at human patient care or a Bachelor of Science or Bachelor of Arts degree may sit for the ARDMS examination immediately after completion of the program under ARDMS prerequisite 1 (for Associate of Science degree in an Allied Health field graduates) and ARDMS prerequisite 3A (for Bachelor of Science or Bachelor of Arts degree graduates) or for ARRT (S) examination. FresnoCampus: Graduates accepted to the program with an Associate Degree in any field or High School Diploma/GED may sit for the ARRT® (S) examination immediately after completion. Upon obtaining ARRT® (S) certification, graduates cansit for the ARDMS examination under ARDMSprerequisite 5. SacramentoandSanJoseCampus: Graduates accepted to the program with an Associate Degree in any field or High School Diploma / GED may sit 83

for the R.T.(S)ARRT® examination immediately after completing the program. Graduates may sit for the ARDMS examinationimmediatelyafterprogramcompletionunderARDMSprerequisite2. For more information about the ARDMS registry and examination, you can visit www.ardms.org or contact them at The American Registry of Diagnostic Medical Sonographers, 51 Monroe Street, Plaza East One, Rockville, MD 20850, Telephone: (301) 738-8401 / Toll-Free: (800) 541-9754, Fax: (301) 738-0312 / 0313. For more information about ARRT® certification and examination, you can visit www.arrt.org or contact them at the American Registry of Radiologic Technologists®, 1255 Northland Drive, St. Paul, MN 55120, (651) 687-0048. Associate of Occupational Science in Vascular Ultrasound Technology Program (A.O.S. in VUT) The law does not require Ultrasonographers to be registered by The American Registry of Diagnostic Medical Sonographers(ARDMS)towork,butsuchcredentialsmayincreasehiringchances. Graduates who were accepted to the program with an Associate of Science degree in an Allied Health field directed at human patient care or a Bachelor of Science or Bachelor of Arts degree may sit for the ARDMS examination immediately after completion of the program under ARDMS prerequisite 1 (for Associate of Science degree in an Allied Health field graduates) and ARDMS prerequisite 3A (for Bachelor of Science or Bachelor of Arts degree graduates) or for ARRT (VS)®, examination. Graduates who were accepted to the program with an Associate Degree in any field or High School Diploma/GEDareeligibletositfortheARRT(VS)®,ARDMS(RVT),andCCI(RVS)examinationsimmediatelyafter completionoftheprogram. For more information about the ARDMS registry and examination, you can visit www.ardms.org or contact them at The American Registry of Diagnostic Medical Sonographers, 51 Monroe Street, Plaza East One, Rockville, MD 20850, Telephone: (301) 738-8401 / Toll-Free: (800) 541-9754, Fax: (301) 738-0312 / 0313. For more information about ARRT® certification and examination, you can visit www.arrt.orgor contact them at the American Registry of Radiologic Technologists®, 1255 Northland Drive, St. Paul, MN 55120, (651) 687-0048. For more information about CCI certification and examination, visit www.cci-online.org or contact them at Cardiovascular Credentialing International, 3739 National Drive, Suite 202, Raleigh, NC 27612, (919) 861-4539. Associate of Science in MRI Program (A.S. in MRI) GraduatesoftheAssociateofScienceinMRIProgrammaysitfortheARRT®(MR)exam. Associate of Science in Nuclear Medicine Technology Program (A.S. in NM) In California, practicing nuclear medicine technologists must have an active Certified Technologist, Nuclear Medicine (CTNM) certificate. The California Department of Public Health, Radiologic Health Branch, offers the certificate. Once certified, the nuclear medicine technologist can legally practice within California. Eligibility for ARRT® Certification Under the ARRT®´s“EquationforExcellence,”candidatesforARRT®certificationmustmeetbasicrequirements in the three components of the equation: 1. Ethics ARRT®Pre-ApplicationReviewProcess The American Registry of Radiologic Technologists requires an applicant for the certifying exam to disclose any history of criminal and misdemeanor proceedings. The specific language is whether you 84

havebeenconvictedofacrimeormisdemeanor,including,butnotlimitedto 1. Misdemeanor 2. GrossMisdemeanor 3. Felony 4. All alcohol and drug-related violations 5. Military Court Martial For this section, “Convicted” includes a criminal proceeding where a finding or verdict of guilty is madeorreturned,but 1. Theadjudication of guilt is either withheld, deferred, or not entered; or 2. Thesentenceissuspendedorstayed,or 3. A criminal proceeding where the individual enters a plea of guilty or no contest (nolo contendere) or 4. Thereisapre-trial diversion. You are NOT required to report offenses committed as a juvenile and were adjudicated through the juvenile court system. An applicant with a concern is advised to obtain a pre-application review of eligibility for certification before entering the program. The information can be obtained from the ARRT® by calling (651) 687-0048 or their website at www.arrt.org. 2. Education Eligibility for certification also specifies the satisfaction of educational preparation requirements. For the primary pathway to certification, eligibility requires completing the respective discipline’s formal educational program accredited by a mechanism acceptable to ARRT®. Candidates must also demonstratecompetencyindidacticcourseworkandanARRT®-specifiedlistofclinicalprocedures. For the post-primary pathway to certification, candidates must hold registration in a supporting category and document ARRT®-specified clinical experience. Further details may be found in the handbooksavailableforeachpost-primarycertification discipline. 3. Examination Finally, eligibility requires candidates for certification, after having met all other qualifications, to pass an examination developed and administered by the ARRT®. The exams assess the knowledge and cognitive skills underlying the intelligent performance of the tasks typically required of staff technologists practicing within the respective disciplines. Exam content is specified on this website andintherespectivehandbookforeachdiscipline. California Department of Public Health, Radiologic Health Branch contact information is MS 7610, P.O. Box 997414, Certification Unit, Sacramento, CA 95899-7414, Phone: (916) 327-5106, Fax: (916) 440-7999, Web: https://www.cdph.ca.gov/Programs/CEH/DRSEM/Pages/RHB-Contact.aspx. Associate of Science in Nursing Program (ADN) Students must take the National Council Licensure Examination (NCLEX-RN) if they have never been licensed as a registered nurse in another state or have not passed the national licensing examination. If you are licensed in Canada, you must take the NCLEX-RN unless you have passed an acceptable five-part Canadian examination. You must have completed an educational program meeting all California requirements. If you lack any educational requirements, you must complete an approved course in that subject before taking the examination. 85

The NCLEX-RNisadministeredbyComputerizedAdaptiveTesting(CAT)andisdesignedtotestknowledge,skills, and abilities essential to safe and effective nursing practice at the entry-level. There is continuous, year-round testing with CAT, allowing eligible candidates to schedule their examination on a date and at the location of their choice. Examination applicants should submit their application to the Board at least six to eight (6 – 8) weeks before they wish to take the examination to allow time for processing and receipt of all required documents.Note:Applicationprocessingtimesvarydependingonworkloadvolumesreceived. The Board will evaluate your application, and if found eligible, you will be provided with essential and detailed instructions regarding the registration process with the NCLEX testing service. PLEASE NOTE: All NCLEX examination registrations with the NCLEX testing service will remain effective for 365 days. Candidates not made eligible by our Board within 365 days will forfeit their registration and fee with the NCLEX testing service. The Board encourages candidates to wait until they are made Board-eligible before registering with the NCLEX testing service. Appropriate fees, including fingerprint and interim permit fees, if applicable. 1. Completed “Application for Licensure by Examination,” including U.S. Social Security Number (SSN) or Individual Taxpayer Identification Number (ITIN). 2. Completedfingerprints using Live Scan or fingerprint card (Hard Card) processing method. 3. Completed“RequestforAccommodationofDisabilities”andaccompanyingform(s). 4. Transcripts will be sent directly from your school of nursing. 5. If applicable, documents and letters explaining prior convictions or disciplinary action and attesting to your rehabilitation as directed in the “Reporting Prior Convictions or Discipline Against Licenses” section of the application packet. REPORTINGPRIORCONVICTIONSORDISCIPLINEAGAINSTLICENSES The Enforcement Division has an Applicant Enforcement Webinar for pre-licensure students and first-time California license applicants with a history of criminal conviction or discipline against another professional license. As of July 1, 2020, applicants are no longer asked about their prior criminal conviction history. Upon receipt of fingerprint results from the California Department of Justice and the Federal Bureau of Investigation, a criminal history will be discovered. All applicants with a history of criminal convictions will have their applications referred for an additional Enforcement Division review. Convictions within seven (7) years of application will receive a full enforcement review. If a student reports any prior discipline against a practical nurse, vocational nurse, or other healthcare-related license. The Enforcement Division must review the application before the applicant is considered for licensing. Note. Taken from the California Board of Registered Nursing website (2019) and retrieved from https://www.rn.ca.gov/applicants/lic-faqs.shtml#discipline. For moreinformationaboutRNlicensingandexamination,youcanvisit https://rn.ca.gov/applicants/lic-faqs.shtml#examination. Gurnick Academy of Medical Arts has determined that the A.S. in Nursing curriculum does not meet the initial licensure requirement in the following states: Alaska. Associate of Science in Physical Therapist Assistant Program (A.S. in PTA) Physical Therapist Assistants must be licensed in California. Examinations include the National Physical Therapy Exam(NPTE)forPTAsandaCaliforniaLawExam(CLE). 86

Physical Therapy Board of California contact information: 2005 Evergreen Street, Suite 1350, Sacramento, CA 95815,Telephone:(916)561-8200,Fax:(916)263-2560. Business and Professions Code of California Section 2635-2639.1 2635.Everyapplicantforalicenseunderthischaptershall,atthetimeofapplication,beapersonover18,not addicted to alcohol or any controlled substance, and have completed the education and training required by Section 2650b (listed below), and not have committed acts or crimes constituting grounds for denial of licensure under Section 480. (a) Except as otherwise provided in this chapter, no person shall receive a license under this chapter without first successfully passing the following examinations, where success is determined based on the examination passing standard set by the board: (1) An examination under the board’s direction to demonstrate the applicant’s knowledge of the laws and regulations related to the practice of physical therapy in California. The examination shall reasonably test the applicant’s knowledge of these laws and regulations. (2) The physical therapy examination for the applicant’s licensure category. The examination for licensure as a physical therapist shall test entry-level competence to practice physical therapy. The examination for licensure as a physical therapist assistant shall test entry-level competence to practice as a physical therapist assistant in the technical application of physical therapy services. (b) An applicant may take the examinations for licensure as a physical therapist or licensure as a physical therapist assistant after the applicant has met the educational requirements for that particular licensure category. (c) The examinations required by the board for a license under this chapter may be conducted by the board or by a public or private organization specified by the board. The examinations may be conducted under a uniform examination system. For that purpose, the board may make arrangements with organizations furnishing examination materials as may, at its discretion, be desirable. Article 5: Educational Standards Section 2650b: (b) The physical therapist assistant education requirements are as follows: (1) Except as otherwise provided in this chapter, each applicant for a license as a physical therapist assistant shall be a graduate of a physical therapist assistant program of an accredited post-secondary institution or institutions approved by the board and shall have completed both the academic and clinical experience required by the physical therapist assistant program and have been awarded an associate degree. (2) Unless otherwise specified by the board by regulation, the educational requirements shall include instruction in the subjects prescribed by the CAPTE of the American Physical Therapy Association or Physiotherapy Education Accreditation Canada or another body as may be approved by the board by regulation andshall include a combination of didactic and clinical experiences. (AmendedbyStats.2015,Ch.426,Sec.20.(SB800)EffectiveJanuary1,2016.) Gurnick Academy of Medical Arts has determined that the A.S. in Physical Therapist Assistant Program meets therequirementsforinitial licensure in all states due to CAPTE accreditation. Associate of Science in Radiologic Technology Program (A.S. in RT) In the State of California, all schools of Radiologic Technology must receive approval from the State of California Department of Public Health Radiologic Health Branch before students can begin a course of instruction. The Associate of Science in Radiologic Technology program at Gurnick Academy of Medical Arts has obtained status as an approved school compliant with the radiographer instructional practices defined by California law. This school approval allows program graduates to take the radiographer certification examination offered by the State of California Department of Public Health. Once certified, the radiographer is legally allowed to practice 87

within California. Eligibility for ARRT® Certification Per ARRT®´s “Equation for Excellence,” candidates for ARRT® certification must meet basic requirements in the three componentsoftheequation: 4. Ethics ARRT®Pre-ApplicationReviewProcess The American Registry of Radiologic Technology requires an applicant for the certifying exam to disclose any history of criminal and misdemeanor proceedings. The specific language is whether you havebeenconvictedofacrimeormisdemeanor,including,butnotlimitedto 1. Misdemeanor 2. GrossMisdemeanor 3. Felony 4. All alcohol and drug-related violations 5. Military Court Martial For this section, “Convicted” includes a criminal proceeding where a finding or verdict of guilty is madeorreturned,but 1. Theadjudication of guilt is either withheld, deferred, or not entered; or 2. Thesentenceissuspendedorstayed,or 3. A criminal proceeding where the individual enters a plea of guilty or no contest (nolo contendere) or 4. Thereisapre-trial diversion. You are NOT required to report offenses committed as a juvenile and were adjudicated through the juvenile court system. An applicant with a concern is advised to obtain a pre-application review of eligibility for certification before entering the program. The information can be obtained from the ARRT® by calling (651) 687-0048 or their website at www.arrt.org. 5. Education Eligibility for certification also specifies the satisfaction of educational preparation requirements. For the primary pathway to certification, eligibility requires completing the respective discipline’s formal educational program accredited by a mechanism acceptable to ARRT®. Candidates must also demonstratecompetencyindidacticcourseworkandanARRT®specifiedlistofclinicalprocedures. For a post-primary pathway to certification, candidates must hold registration in a supporting category and document ARRT® specified clinical experience. Further details may be found in the handbooksavailableforeachpost-primarycertification discipline. 6. Examination Finally, eligibility requires candidates for certification, after having met all other qualifications, to pass an examination developed and administered by the ARRT®. The exams assess the knowledge and cognitive skills underlying the intelligent performance of the tasks typically required of staff technologists practicing within the respective disciplines. Exam content is specified on this website andintherespectivehandbookforeachdiscipline. California Department of Public Health, Radiologic Health Branch contact information is MS 7610, P.O. Box 997414, Certification Unit, Sacramento, CA 95899-7414, Phone: (916) 327-5106, Fax: (916) 440-7999, Web: 88

https://www.cdph.ca.gov/Programs/CEH/DRSEM/Pages/RHB-Contact.aspx. The law requires that radiologic technologists be licensed to practice as radiographers. Completing the Associate of Science in Radiologic Technology program at Gurnick Academy of Medical Arts may not automatically qualify the graduate to apply for the ARRT® examination. Some employers might require the radiologic technologist to have an ARRT® certification in addition to the State of California certification. BachelorofScienceinRadiationTherapyProgram(B.S.inRT) In California, all schools of Radiologic Technology must receive approval from the State of California Department of Public Health Radiologic Health Branch before students can begin a course of instruction. The Bachelor of Science in Radiation Therapy program at Gurnick Academy of Medical Arts has obtained status as an approved school compliant with the Therapeutic Radiologic Technology instructional practices defined by California law. This school approval allows graduates of the program to apply to sit for the American Registry of Radiologic Technologists® (ARRT®) examination and apply for the California Department of Public Health, Radiologic Health Branch for the Therapeutic Radiologic Technologist licensure. This school approval allows graduates of the program to apply to sit for the American Registry of Radiologic Technologists® (ARRT®) examination and apply for the California Department of Public Health, Radiologic Health Branch for the Therapeutic Radiologic Technologist licensure. Eligibility for ARRT® Certification Per ARRT’s® “Equation for Excellence,” candidates for ARRT® certification must meet basic requirements in the three componentsoftheequation: 1. Ethics ARRT®Pre-ApplicationReviewProcess The American Registry of Radiologic Technology requires an applicant for the certifying exam to disclose any history of criminal and misdemeanor proceedings. The specific language is whether you havebeenconvictedofacrimeormisdemeanor,including,butnotlimitedto. 1. Misdemeanor 2. GrossMisdemeanor 3. Felony 4. All alcohol and drug-related violations 5. Military Court Martial For this section, “Convicted” includes a criminal proceeding where a finding or verdict of guilty is madeorreturned,but 1. Theadjudication of guilt is either withheld, deferred, or not entered; or 2. Thesentenceissuspendedorstayed,or 3. A criminal proceeding where the individual enters a plea of guilty or no contest (nolo contendere) or 4. Thereisapre-trial diversion. You are NOT required to report offenses committed as a juvenile and were adjudicated through the juvenile court system. An applicant with a concern is advised to obtain a pre-application review of eligibility for certification before entering the program. The information can be obtained from the ARRT® by calling (651) 687-0048 or their website at www.arrt.org. 2. Education 89

Eligibility for certification also specifies the satisfaction of educational preparation requirements. For the primary pathway to certification, eligibility requires completing the respective discipline’s formal educational program accredited by a mechanism acceptable to ARRT®. Candidates must also demonstratecompetencyindidacticcourseworkandanARRT®specifiedlistofclinicalprocedures. For a post-primary pathway to certification, candidates must hold registration in a supporting category and document ARRT® specified clinical experience. Further details may be found in the handbooksavailableforeachpost-primarycertification discipline. 3. Examination Finally, eligibility requires candidates for certification, after having met all other qualifications, to pass an examination developed and administered by the ARRT®. The exams assess the knowledge and cognitive skills underlying the intelligent performance of the tasks typically required of staff radiologic therapeutic technologists practicing within the respective disciplines. Exam content is specified on this website and in the respective handbook for each discipline. California Department of Public Health, Radiologic Health Branch contact information is MS 7610, P.O. Box 997414, Certification Unit, Sacramento, CA 95899-7414, Phone: (916) 327-5106, Fax: (916) 440-7999, Web: https://www.cdph.ca.gov/Programs/CEH/DRSEM/Pages/RHB-Contact.aspx. BachelorofScienceinNursingProgram(BSN) Students must take the National Council Licensure Examination (NCLEX-RN) if they have never been licensed as a registered nurse in another state or have not passed the national licensing examination. If you are licensed in Canada,youmusttaketheNCLEX-RNunlessyouhavepassedanacceptablefive-partCanadianexamination. You must have completed an educational program meeting all California requirements. If you lack any educational requirements, you must complete an approved course in that subject before taking the examination. The NCLEX-RNisadministeredbyComputerizedAdaptiveTesting(CAT)andisdesignedtotestknowledge,skills, and abilities essential to safe and effective nursing practice at the entry-level. There is continuous, year-round testing with CAT, allowing eligible candidates to schedule their examination on a date and at the location of their choice. Examination applicants should submit their application to the Board at least six to eight weeks before taking the examination to allow time for processing and receipt of all required documents. Note: Application processing times vary depending on workload volumes received. The Board will evaluate your application, and if you are found eligible, you will be provided with important and detailed instructions regarding the registration process with the NCLEX testing service. PLEASE NOTE: All NCLEX examination registrations with the NCLEX testing service will remain effective for 365 days. Candidates not made eligible by our Board within 365 days will forfeit their registration and fee with the NCLEX testing service. The Board encourages candidates to wait until they are made Board-eligible before registering with the NCLEX testing service. Appropriate fees, including fingerprint and interim permit fees, if applicable. 1. Completed “Application for Licensure by Examination,” including U.S. Social Security Number (SSN) or Individual Taxpayer Identification Number (ITIN). 2. Completedfingerprints using the Live Scan or fingerprint card (Hard Card) processing method. 3. Completed“RequestforAccommodationofDisabilities”andaccompanyingform(s). 4. Transcripts will be sent directly from your school of nursing. 5. If applicable, submit documents and letters explaining prior convictions or disciplinary action and 90

attesting to your rehabilitation as directed in the “Reporting Prior Convictions or Discipline Against Licenses” section of the application packet. If applicable, submit documents and letters explaining prior convictions or disciplinary action and attesting to your rehabilitation as directed in the “Reporting Prior Convictions or Discipline Against Licenses” section of the application packet. Gurnick Academy of Medical Arts has determined that the B.S. in Nursing Program does not meet the initial licensure requirement in the following states: Alaska. BoneDensitometryTechnicianProgram(DXA) In the State of California, all schools of Limited Scope of Practice in Radiography must receive approval from the State of California Department of Public Health Radiologic Health Branch (CDPH-RHB) before students can begin a course of instruction. The Bone Densitometry Technician program at Gurnick Academy of Medical Arts has obtained status as an approved school compliant with the limited practice technician instructional practices defined by California law. This school approval allows graduates of the program to take the limited practice technical certification in Dual Energy X-ray Absorptiometry (DEXA) Permit category examination offered by the State of California Department of Public Health. Once certified, the technician is legally allowed to practice within California. California Department of Public Health, Radiologic Health Branch contact information is MS 7610, P.O. Box 997414, Certification Unit, Sacramento, CA 95899-7414, Phone: (916) 327-5106, Fax: (916) 440-7999, Web: http://www.dhs.ca.gov/rhb. The law requires that bone densitometry technicians be certified to practice as limited practice technicians. Completing the Bone Densitometry Technician program at Gurnick Academy of Medical Arts may not automatically qualify the graduate to apply for the examination with CDPH-RHB proctored by the ARRT®. Some employers might require the radiologic technologist to have an ARRT® certification in addition to the State of California certification. DentalAssistant Program(DA) California does not require a dental assistant to be certified as a dental assistant. However, such a certificate may increase the chances of being hired. The Dental Board of California requires a written examination to becomeaRegisteredDentalAssistant(RDA). Eligibility to apply for the examination includes the following requirements: 15 months of satisfactory work experience (eight (8) months in a DA program and seven (7) months of on-the-job experience). In addition, the application requires the following elements in the program: an 8-hour Infection Control Certificate, a Coronal Polishing Certificate, and a Radiation Safety Certificate. *Dental Practice Act Certification and Pit and Fissure Certification (completed outside the DA program) are also required for the RDA application. MedicalAssistantProgram(MA) California does not require that medical assistants be certified, but such a certificate may increase hiring chances. The national CCMA exam is taken during the program upon completing didactic coursework. While students are required to pass the CCMA exam to work as medical assistants, students who pass the exam and meetgraduationrequirementswillbeeligibletoworkasCertifiedMedicalAssistants. Vocational Nurse Program (VN) ToworkasaVocationalNurseinCalifornia,youmustpassalicensingexaminationadministeredbytheNational 91

Council Licensure Examination (NCLEX-PN). Completing this program does not automatically enable a graduate to work as a Vocational Nurse. The BVNPT accredits the Gurnick Academy of Medical Arts Vocational Nurse Programandrequiresdisclosingthefollowinginformationfromtheirwebsite: SummaryofRequirementsforLicensureasaVocationalNurse Section A 1. MinimumAge–17Years. 2. Completingthe12thGradeofschoolingoritsequivalent(furnishproof). 3. Completeandsignthe“ApplicationforVocationalNurseLicensure.” 4. CompleteandsigntheRecordofConvictionform. 5. Submit the required fingerprints from the Department of Justice (DOJ) and the Federal Bureau of Investigation (FBI). (See “Important Fingerprint Information.”) Note: A License will not be issued until the Board receives the background information from DOJ. 6. Attach the appropriate non-refundable fee made payable to the “BVNPT.” 7. Successful completion of a written examination titled the National Council Licensing Examination for Practical (Vocational) Nursing (NCLEX) or the National League for Nursing Test Pool Practical Nursing Examination (NLN). A passing score on a Registered Nurse examination will not satisfy this requirement. 8. When the requirements of Steps one through seven (1 – 7) have been met, the Board will advise youoftheInitial License Fee to be paid. This fee is in addition to the application fee. Processing your license takes four to six (4 – 6) weeks. Section B 1. GraduateofaCaliforniaAccreditedSchoolofVocationalNursing. Successful completion of a California Accredited Vocational Nursing Program; Contact your program director for application forms and instructions. 2. GraduateofanOut-of-StateSchoolofPractical/VocationalNursing. The Board of Nursing must have accredited the school of practical/vocational nursing from which yougraduatedintheStateinwhichitislocated. (Licensure in another state does NOT entitle you to practice as a Licensed Vocational Nurse in California. To practice as a Licensed Vocational Nurse in California, you must be licensed by the California State Board of Vocational Nursing and Psychiatric Technicians.) 3. Equivalent Education and Experience. This method requires you to complete within ten (10) years before the date of application not less than fifty-one (51) months of paid general duty bedside nursing experience in a general acute care facility approved by the Board. At least half of this must have been within five (5) years before the date of application. In addition to this experience, you must also complete a pharmacology course of at least 54 theory hours that covers the following content: ● Knowledgeofcommonlyuseddrugsandtheiraction ● Computationofdosages ● Preparationofmedications ● Principlesofadministration The51monthsofexperienceshallincludeaminimumofeachofthefollowing: ● 48monthsofmedical/surgicalnursing ● Five(5)weeksofmaternityorgenitourinarynursing ● Five(5)weeksofpediatricnursing 92

Experience in any of the following areas may be substituted for a maximum of eight (8) months of medical/surgical experience: ● CommunicableDiseaseNursing ● PublicHealthNursing ● IndustrialNursing ● OfficeNursing(M.D.) ● PsychiatricNursing ● OperatingRoomNursing ● Hemodialysis ● PrivateDutyNursing(Inageneralacutecarefacility) ● EmergencyRoomNursing ● GeriatricNursing ● RecoveryRoomNursing ● Out-PatientClinic Experience must be verified by the employer, showing specific dates of employment. It shall include certification from the R.N. Director or Supervisor that the applicant has satisfactorily demonstrated thefollowing knowledgeandskills: a. Basic Bedside Nursing ● AmbulationTechniques ● IntakeandOutput ● Bedmaking ● NeurologicalCheck ● CatheterCare ● PersonalHygieneandComfortMeasures ● CollectionofSpecimens ● Positioning&Transfer ● DiabeticUrineTesting ● RangeofMotion ● Enema ● SkinCare b. Aseptic Technique (May be demonstrated in the classroom, lab, and patient care settings) ● UrinaryCatheterization ● SterileDressingChange ● SterileIrrigations Applicants with formal nursing education may submit official transcripts for evaluation for possible credit instead of paid bedside nursing experience. The transcripts must be submitted to the Board directly from the school and show theory and clinical hours completed. c. Nursing Service in the Medical Corps of any Branch of the Armed Forces of the United States. This method requires you to ● Submit proof of having at least twelve (12) months of active duty in the Armed Forces medical corps, rendering bedside patient care. The proof submitted must showthedate(s)andwardsassigned. ● Submit proof of completing a basic course of instruction in nursing while in the armedforces. ● Submitproofthatservicewashonorable(DD-214). 93

● Note: A combination of military and nonmilitary experience is unacceptable under this method. Proof of 12th-grade education is not required under this method. d. 4-Year Expired California Licensed Vocational Nurse. Section 2892.1 of the Business and Professions Code specifies that a license not renewed for four (4) years shall expire. An expired license cannot be renewed, reissued, or reinstated. The licensee must submit a new application and retake the licensure examinationtoreceiveanewlicense. Applicants under this method must submit evidence of prior licensure with this Board (i.e., copyofanexpiredlicenseorlicensenumber,originalissuedate,andexpirationdate.) Please note that State Boards of Nursing require graduation from accredited nursing schools in many states. Please be aware that if you are deemed eligible for licensure in California using another method of qualifying (i.e., military experience or equivalent education and experience), you may not qualify for licensure by endorsementinotherstates. Gurnick Academy of Medical Arts has determined that the Vocational Nurse Program does not meet the initial licensure requirement in the following states: Alaska. X-ray Technician with Medical Assistant Skills Program (XTMAS) In California, all schools of Limited Scope of Practice in Radiography must receive approval from the State of California Department of Public Health Radiologic Health Branch (CDPH-RHB) before students can begin a course of instruction. The XTMAS program at Gurnick Academy of Medical Arts has obtained status as an approved school. It complies with the limited practice technician instructional practices defined by California law. This school approval allows program graduates to take the limited practice technician licensure examination offered by the State of California Department of Public Health. Once certified, the Limited Practice Technician may legally practice within California. Education Eligibility for a license also specifies the satisfaction of educational preparation requirements. For the primary pathway to certification, eligibility requires completing the respective discipline’s formal educational program that the CDPH-RHB accredits. Candidates must also demonstrate competency in didactic coursework specified by the CDPH-RHB list of clinical procedures. Examination: After meeting all other qualifications, eligibility requires candidates for certification to pass an examination developed and administered by the ARRT®. The exams assess the knowledge and cognitive skills underlying the intelligent performance of the tasks typically required of staff technicians practicing within the respective disciplines. Exam content is specified on this website and in the respective handbook for each discipline. California Department of Public Health, Radiologic Health Branch contact information is MS 7610, P.O. Box 997414, Certification Unit, Sacramento, CA 95899-7414, Phone: (916) 327-5106, Fax: (916) 440-7999, Web: https://www.cdph.ca.gov/Programs/CEH/DRSEM/Pages/RHB-Contact.aspx. It is required by law that Limited Practice Technicians be certified to practice. Completing the XTMAS program at Gurnick Academy of Medical Arts may not automatically qualify the graduate to apply for the State examination. PASSPROGRAM 94

ThePostAcademicStudentSuccess(PASS)Programisastructuredlicensurereviewseriesexplicitlydesignedfor Vocational Nurse program graduates to improve the licensure pass rates and increase contact with our graduates. The program is free of charge, and graduates must attend the PASS Program in full to receive financial incentives. Participants must meet with the Career Services Coordinator to sign up for the PASS Program. Graduates are expected to receive their approval to test letters approximately six (6) weeks after graduating from Gurnick AcademyofMedicalArts.TheirapplicationhasbeensuccessfullysentandacceptedbytheBVNPT. FINANCIALPOLICIES ALUMNIGRANTS&SCHOLARSHIP Students who graduate from one Gurnick programandenrollinadditionalprogramsmayqualifyforanalumni grant or scholarship as specified by Gurnick Academy of Medical Arts. The grants or scholarships are tied to specific programs, and the amount of grant or scholarship given per program varies. Please speak with an AdmissionsAdvisorfordetails. Programsthatofferalumnigrantsareasfollows: ● BSDMI:RTGrad($2,000) ● LVN-ADN:VNGrad($16,468) ● LVN-BSNProgram:VNGrad($19,000);ASVNGrad($3,000) ● RN-BSNProgram:ADNGrad($1,800) ● VNProgram:MAGrad($1,900) ● MSN:BSNGrad($1,800) Programsthatofferscholarshipsareasfollows: ● AnyFullImagingProgramtoAnotherFullImagingProgram:Variesperyearwithamaxof$10,000fora st single recipient. The deadline to apply is December 1 for the following year. FEEANDTUITIONINFORMATION All fees and tuition are subject to change without notice, with an effective date noted in the catalog addendum for enrollments that occur after that. The tuition covers the cost of all classroom instruction. For programs scheduled to be completed within four (4) months from the start date, all fees and tuition are to be paid before the first day of class or other deadline dates as may be posted occasionally in the admissions office or on our website. Payment arrangements are made at the time of enrollment. Affordable monthly paymentsareavailable;pleasecontactanadmissionadvisortodiscussfurtherdetails. Private student loans are available for those who qualify. Please check for detailed information on current loans available under Financial Aid. If a student receives a loan to pay for the educational program, the student will be responsible for repaying the full amount of the loan plus interest, less the amount of any refund. The schedule of total charges for a period of attendance and an estimated schedule of total charges for the entire educational program are the same. 95

REFUND Student’s Right to Cancel 1. Youareentitledtocancelyourinstructionprogramwithoutpenaltyorobligation. a. A full refund of all tuition and fees paid will be made if a student cancels their Enrollment Agreementbynotifyingtheschoolwithinthreedaysofenrollmentor b. Cancels their Enrollment Agreement through attendance at the first class session or the seventh calendar day of the student’s start date, whichever is later. The academy will refund the student any money they paid, less any registration fees not to exceed the specified amount, within 45 days after the notice of cancellation is received if cancellation occurs later than three (3) days after enrollment. 2. After the end of the cancellation period, you also have the right to stop school at any time. You also have the right to receive a proportional refund if you have completed 60 percent or less of the scheduleddaysinthecurrentpaymentperiodinyourprogramthroughthelastdayofattendance. 3. Cancellation may occur when the student provides a written or oral cancellation notice at the enrolling campus.Thiscanbedonebymail,handdelivery,oroverthephone. 4. The written notice of cancellation, if sent by mail, is effective when deposited in the mail and properly addressedwithproperpostage. 5. The written notice of cancellation need not take any particular form and is effective if it indicates that thestudentnolongerwishestobeboundbytheEnrollmentAgreement. WithdrawalfromtheProgram You may withdraw from the school at any time after the cancellation period (described above) in writing or orally to a Campus Official and receive a proportional refund if you have completed 60 percent or less of the scheduleddaysinthecurrentpaymentperiodinyourprogramthroughthelastdayofattendance. The refund will be less a registration not to exceed the specified amount and less any deduction for books accessed and equipment and materials not returned in good condition within 45 days of withdrawal for applicable students. If the student has completed more than 60% of the period of attendance for which the student was charged, the tuition is considered earned, and the student will receive no refund. The student’s withdrawal date shall be deemed the last recorded attendance date to determine a refund under this section. A student is considered withdrawn from a program of instruction (date of determination) when anyofthefollowingoccurs: ● The student notifies Gurnick Academy of Medical Arts of the student’s withdrawal or the withdrawaldate,whicheverislater. ● Gurnick Academy of Medical Arts terminates the student’s enrollment for failure to maintain satisfactory progress, failure to abide by the rules and regulations of the institution, absences exceeding the maximum set forth by the institution, or failure to meet financial obligations to the school. ● Thestudenthasnotattendedclassesfor14calendardays. ● Failuretoreturnfromaleaveofabsence. For programs beyond the current “payment period,” if you withdraw before the next payment period, all charges collected for the next period will be refunded. Tuition paid from the proceeds of a loan or third party should be refunded to the lender, third party, or the state or federal agency that guaranteed or reinsured the loan. Any amount of the refund over the unpaid balance of the loan shall be first used to repay any student financial aid programs from which the student received benefits proportionately to the amount received. Any remainingamountshallbepaidtothestudent. 96

If the student has received federal student financial aid funds, the student is entitled to a refund of monies not paid from federal student financial aid program funds. ContinuingEducationCoursesRefundPolicy Please read this policy on www.gurnick.edu/terms/ as it differs from the above-stated Refund Policy. GRADUATESURVEYSANDPLACEMENTDATA(GSPD) Students are eligible to receive an incentive within 30 days after the student has completed and returned to Gurnick Academy of Medical Arts the Graduate Survey and Placement Data form. The submission of the form occurs before the sixth month of graduation. If the student has found employment, the student can submit the form any time before the sixth month. If the student still needs to be employed within six (6) months of graduating, they may submit the form still explaining their situation to receive the incentive. STUDENTTUITIONRECOVERYFUND The State of California established the Student Tuition Recovery Fund (STRF) to relieve or mitigate economic loss suffered by a student in an educational program at a qualifying institution who is or was a California resident while enrolled or was enrolled in a residency program if the student enrolled in the institution, prepaid tuition, and suffered an economic loss. Unless relieved of the obligation to do so, you must pay the state-imposed assessment for the STRF, or it must be paid on your behalf if you are a student in an educational program, who is a California resident, or are enrolled in a residency program, and prepay all or part of your tuition. You are not eligible for protection from the STRF and are not required to pay the STRF assessment if you are not aCalifornia resident or enrolled in a residency program. You must keep copies of your enrollment agreement, financial aid documents, receipts, or any other information documenting the amount paid to the school. Questions regarding the STRF may be directed to the Bureau for Private Postsecondary Education, 1747 North Market, Suite 225, Sacramento, CA 95834, (916) 574-8900,or(888)370-7589. To be eligible for STRF, you must be a California resident or enrolled in a residency program, prepaid tuition, paid or deemed to have paid the STRF assessment, and suffered an economic loss as a result of any of the following: 1. The institution, a location of the institution, or an educational program offered by the institution was closed or discontinued, and you did not choose to participate in a teachout plan approved by the Bureau or did not complete a chosen teach-out plan approved by the Bureau. 2. You were enrolled at or at a location of the institution within 120 days before the closure of the institution or location of the institution or were enrolled in an educational program within 120 days before the program was discontinued. 3. You were enrolled at an institution or a location of the institution more than 120 days before the closure of the institution or location of the institution in an educational program offered by the institution as to which the Bureau determined there was a significant decline in the quality or value of the program more than 120 days before closure. 4. TheBureauhasorderedtheinstitutiontopayarefundbutfailedtodoso. 97

5. The institution has failed to pay or reimburse loan proceeds under a federal student loan program as required by law or has failed to pay or reimburse proceeds received by the institution exceeding tuition and other costs. 6. You have been awarded restitution, a refund, or other monetary award by an arbitrator or court based on an institution’s or representative’s violation of this chapter but have been unabletocollect the award from the institution. 7. You sought legal counsel that resulted in the cancellation of one or more of your student loans and have an invoice for services rendered and evidence of the cancellation of the student loan or loans. The application must be received within four (4) years from the date of the action or event that made the student eligible for recovery from STRF to qualify for STRF reimbursement. A student whose loan is revived by a loan holder or debt collector after a period of non-collection may, at any time, file a written application for recovery from STRF for the debt that would have otherwise been eligible for recovery. If it has been more than four (4) years since the action or event that made the student eligible, the student must have filed a written application for recovery within the original four (4) years unless another act of law has extended the period. However,noclaimcanbepaidtoanystudentwithoutasocialsecurityortaxpayeridentificationnumber. FINANCIALAIDINFORMATION Gurnick Academy of Medical Arts aims to assist every student in obtaining financial aid that enables them to attend their chosen program of study. Gurnick Academy of Medical Arts participates in various federal and state student financial assistance programs. The financial aid programs are designed to assist students whose financial resources are inadequate to meet the full cost of their education. Each campus has a Financial Aid Advisor to address financial aid questions. Most financial aid available to students is federal student financial aid administered by the U.S. Department of Education. This includes the Federal Pell Grant, Federal Supplemental Educational Opportunity Grant (FSEOG), Federal Direct Loans, Federal Parent Loans for Undergraduates (PLUS), and Federal Work-Study (FWS). The Children of Fallen Heroes Scholarship and the Iraq Afghanistan Service Grant are available to qualifying students. Cal Grants are available from California for eligible students in qualifying programs. After federal and state aid, students with unfunded balances can consider payment plans and private educational loans. The primary responsibility for meeting education costs rests with the individual student and their family. All financial aid is awarded based on need, regardless of sex, age, race, color, religion, creed, sexual orientation, or national origin. Need is defined as the difference between the Cost of Attendance (COA) for one academic year and the amount a student’s family is expected to contribute for the same period, referred to as the Expected Family Contribution (EFC). All students must complete the Free Application for Federal Student Aid (FAFSA) to be considered for federal and state aid; the income and asset information reported on the FAFSA calculates the EFC. Per the Privacy Act of 1974, as amended (Privacy Act), the Chief Operating Officer for Federal Student Aid (FSA) of the U.S. Department of Education (Department) publishes this notice of a modified system of records entitled the “National Student Loan Data System” (NSLDS) (18-11-06). The information contained in this system is maintained for various purposes relating to aid applicants and recipients. These include determining aid applicants’ and recipients’ eligibility for Federal student financial assistance under the programs authorized by Title IV of the Higher Education Act of 1965, as amended (HEA); assisting institutions of higher education participating in and administering the Title IV, HEA programs by verifying the eligibility of borrowers for, and tracking, loans; and assisting the Department’s oversight and administration of the Title IV, HEA programs, including evaluating their effectiveness. 98

HOWTOAPPLYFORFINANCIALAID 1. All students must complete the Free Application for Federal Student Aid (FAFSA) to be considered for federal and state aid; the income and asset information reported on the FAFSA calculates the EFC. TheschoolcodeforGurnickAcademyofMedicalArtsis041698. TheFAFSAcanbecompletedonlineatwww.studentaid.gov/h/apply-for-aid/fafsa. 2. The student needs an FSA ID to sign the FAFSA electronically. To apply for an FSA ID, go to www.studentaid.gov/fsa-id/create-account/launch. Students will also use the FSA ID to complete the MPN for student loans, complete online counseling, and view their student loan data at www.studentaid.govandNSLDS. The parent of a dependent student will also need an FSA ID to sign the FAFSA electronically and throughoutthePLUSLoanprocess. 3. The FAFSA uses income information from the calendar year two years before the award year. The student and the parent should strongly consider using the IRS Data Retrieval Tool (DRT) within the FAFSAtopopulatetheapplicationwithincomeinformationdirectlyfromtheIRS. 4. Students will receive their FAFSA results within a few days via email with a URL for their Student Aid Report(SAR)orbyUSmail.Theschoolwillalsoreceivetheresultselectronically,calledtheISIR. Students must apply for financial aid every year. The FAFSA must be received by a deadline published annually by the California Student Aid Commission to be eligible for the Cal Grant. This deadline can be viewed on the FAFSAwebsite. The school uses the ISIR data to prepare the students’ Financial Plans. Federal and state aid may not cover the total cost, depending on the student’s program. Students can cover the unfunded balance by paying in full, with a payment plan (payment in full required before graduation), or by a private education loan. Talk to your campusfinancialaidadvisortodeterminethebestoption. GENERALSTUDENTELIGIBILITYREQUIREMENTS Tobeconsideredforfederalfinancialaid, a student must: ● HaveavalidSocialSecurityNumber. ● BeaU.S.citizenoreligiblepermanentresident. ● Possessahighschooldiplomaortheequivalent. ● Enrollinaneligibleprogramasaregularstudentseekingadegree,diploma,orcertificate. ● Donotdefaultonstudentloansorowearefundofgrantfunds. ● MaintainSatisfactoryAcademicProgressasdescribedintheschoolcatalog. Most formsoffinancial aid require a student’s need, defined as Cost of Attendance minus the EFC, as calculated from the FAFSA data. Direct Unsubsidized loans, PLUS loans, and private education loans are not need-based, buteligibility is based on the Cost of Attendance, less other aid. Financial aid from federal programs is not guaranteed from one year to the next. Each student must reapply every year. The award year for most financial aid programs runs from July 1 to June 30 of the following year, but aid is awarded based on the academic year defined for the student’s program of study. Somestudentapplicationsareselectedforaverificationprocess.Toreceivefinancial aid, students must provide documents supporting the FAFSA information. Selected students will be notified of their verification status and supporting documents required by the Financial Aid Office. Students must verify and resolve flags or comment codesbeforefinancial aid is disbursed. 99

FEDERALFINANCIALAIDPROGRAMS Federal financial aid programs include the Federal Pell Grant, Federal Supplemental Opportunity Grant (FSEOG), Federal Direct Subsidized Loans, Federal Direct Unsubsidized Loans, and PLUS Loans. The Iraq Afghanistan Service Grant and the Children of Fallen Heroes Scholarship are additional federal aid programs. Federal Pell Grant This grant is designed to assist students with the greatest need. Federal Pell Grants are only awarded to undergraduateswithoutabachelor’sorprofessionaldegreeorequivalent.Thestudent’sneeds,thecostof attendance, and the amount appropriated annually by Congress to fund the program determine eligibility. Pell Grants are gift aid and are not repaid. FSEOG This grant is available to students with exceptional financial need, defined as students with the lowest EFC, and given to Federal Pell Grant recipients. The amount of the grant and the number of students who may receive this grant depend on the availability of funds determined annually by Congress and the U.S. Department of Education. The funds are awarded proportionally across Gurnick Academy of Medical Arts’ campuses and program start dates. The grant amounts vary; the average is $600 for an award year. FSEOG awards are gift aid and are not repaid. When awarding students, regardless of campus, we first award based on EFC and finalization date. We first award all students who have a 0 EFC and whose files are cleared and ready to finalize their financial aid first. Once all these students have been awarded, we award them with the lowest EFCs whose files are cleared and readytofinalize their financial aid. Students are only eligible for FSEOG in their first academic year. In dealing with students who re-enroll within six (6) months from the last date of attendance, we will allow them to receive the remaining disbursements if they have already been awarded but have yet to receive all disbursements. If the student re-enrolls more than six (6) months from the last date of attendance, they will not receive any further disbursements. (If the re-enrolled student has not been awarded initially, we will not award funds for this enrollment). If a student withdraws from one program and then enrolls in a new program, regardless of whether they enroll within six (6) months or have received an award in the prior program, that student is eligible to be awarded. Example:astudentwhowithdrawsfromtheMAprogramandenrollsintheVNprogram Federal Work-Study(FWS) TheFederalWork-StudyProgramprovidespart-timeemploymenttostudentswhorequiretheearningsto defray the cost of their education. Students may work on or off-campus for a qualified public, private, or communityserviceorganization. Eligibility is based on financial need and the availability of funds. The school will attempt to place students in jobs related to their program of study, and work schedules will be arranged according to class schedules. Congress and the U.S. Department of Education provide the funding that determines the school’s allocation amountandthenumberofstudentswhomayreceivethesefunds. 100

Direct Subsidized and Unsubsidized Loans There are two types of Direct Loans: Subsidized and Unsubsidized. Students must have financial need to receive a Subsidized Direct Loan. The federal government pays the interest that accrues during specific Subsidized Loan periods, including while the student is in school or has an approved deferment status. Financial need is not a requirement for an Unsubsidized Direct Loan. Students must pay the interest that accrues on Unsubsidized Direct Loans while in school or choose to capitalize the interest (add it to the loan principal). The interest rates for Subsidized and Unsubsidized loans are set annually and can be found by visiting https://studentaid.gov/understand-aid/types/loans/interest-rates. Congress establishes the annual loan limits, which vary by student dependency status, the program of study, and year in school. The net amount of loan funds disbursed to the student is less than the gross loan amount by the origination fee, determined annually and foundonthewebsitelistedabove.ThefundsforDirectLoanscomefromthegovernmentandarerepaidto thegovernmentvialoanservicers. Federal student loans must be repaid. Students or parents who default on their student loans will lose their ability to receive federal aid in the future and can have their tax refunds taken, and wages garnished. Direct PLUS Loans PLUSLoansareloansparentscanobtaintohelppayforeducationfortheirdependentundergraduatechildren. Financial need is not a requirement for a PLUS Loan. The limit to a PLUS Loan amount is the Cost of Attendance minusotheraid.ParentsmustpaytheinterestaccruedonPLUSLoanswhilethestudentisinschool. Theinterest rates for PLUS loans are set annually and can be found here: https://studentaid.gov/understand-aid/types/loans/interest-rates. The net amount of loan funds disbursed to the parent is less than the loan’s gross amount, less the origination fee, determined annually and found at the website listed above. The funds for all Direct Loans come from the government and are repaid via loan servicer companies. PLUS Loans are credit-based; parent borrowers will have a credit check as part of the application process and cannot have adverse credit. If a parent is denied based on adverse credit, they can obtain an endorser for the loan. A student’s parents can apply for a PLUS Loan (biological or adoptive or current if their information would beincludedontheFAFSA).ThePLUSparentborrowerdoesnothavetobethecustodialparent. Iraq Afghanistan Service Grant Students maybeeligible to receive the Iraq and Afghanistan Service Grant (IASG) if they: ● AreineligibleforaFederalPellGrant basedontheirEFC,but ● MeettheremainingFederalPellGranteligibilityrequirementsand ● TheirparentorguardianwasamemberoftheU.S.armedforcesanddiedasaresultofmilitary service performed in Iraq or Afghanistan after the events of 9/11 and ● Thestudentwasunder24yearsoldorenrolledincollegeatleastpart-timeatthetimeofthe parent’s or guardian’s death. Students eligible for the Iraq Afghanistan Service Grant will have a flag and associated comments on their StudentAidReport. IASGawardsaregiftaidandarenotrepaid. Children of Fallen Heroes Scholarship APell-eligible student whose parent or guardian died in the line of duty while performing as a public safety officer is eligible for the Children of Fallen Heroes (CFH) award. The CFH award is a maximum Pell Award, and all other need-basedaidisawardedusinga0EFC(maximumeligibility).Thestudentmust: 101

● HaveaPell-eligibleEFC. ● Beenrolledinanundergraduateprogram. ● Nothaveearnedabaccalaureateorfirstprofessionaldegreeorequivalent,and ● Belessthan24yearsofageorenrolledataninstitutionofhighereducationatthetimeoftheir parent’s or guardian’s death. The student remains eligible for the Children of Fallen Heroes (CFH) award in subsequent years if the student is Pell-eligible, has a Pell-eligible EFC, and is otherwise eligible. PUBLICSAFETYOFFICER For purposes of the CFH award, a public safety officer is: ● A fire or police officer is defined as an individual who is serving under state or local law as an officially recognized or designated member of a legally organized public safety agency and provides scene security or directs traffic responding to any fire drill, fire call, or other fire, rescue or police emergency,orataplannedspecialevent;or ● Asdefined in section 1204 of Title I of the Omnibus Crime Control and Safe Streets Act of 1968 (42 U.S.C 3796b). CFHawardsaregiftaidandarenotrepaid. Professional Judgment TheFAFSASimplification Act (the Act) distinguishes between different categories of professional judgment by amendingsection479AoftheHEA. ● Special Circumstances refer to the financial situations (loss of a job, etc.) that justify an aid administrator adjusting data elements in the COA or the EFC calculation. ● Unusual Circumstances refer to the conditions that justify an aid administrator adjusting a student’s dependency status based on a unique situation (e.g., human trafficking, refugee or asylee status, parental abuse or abandonment, incarceration), more commonly referred to as a dependency override. Special Circumstances An aid administrator may use PJ on a case-by-case basis to adjust the student’s cost of attendance or the data usedtocalculatetheir EFC. This adjustment is valid only at the school making the change. If you exercise PJ for a student selected for verification (by you or the Department), you must complete verification first. You do not have to verify the information you will remove due to PJ. For example, if a dependent student’s parents have separated after completion of the FAFSA form and one parent is no longer in the household size, youmaydecidetousePJtoremovethatparent’sincomefromtheFAFSAform. You donothavetoverifythatparent’sincomebeforeremovingit.Also,usingPJdoesnotrequireyoutoverifya student’s application if they were not already selected for verification by the Department or your school. You must resolve any inconsistent or conflicting information before making any adjustments. An FAA’s decision regarding adjustments is final and cannot be appealed to the Department. ThelawgivessomeexamplesofspecialcircumstancesthatMAYbeconsidered(HEASec.479A): ● Changeinemploymentstatus,income,orassets ● Changeinhousingstatus(e.g.,homelessness) ● Tuitionexpensesatanelementaryorsecondaryschool ● Medical,dental,ornursinghomeexpensesnotcoveredbyinsurance ● Childordependentcareexpenses ● Severedisabilityofthestudentorothermemberofthestudent’shousehold ● Otherchangesoradjustmentsthatimpactthestudent’scostsorabilitytopayforcollege. 102

UnusualCircumstances TheFAFSASimplification Act provides a clearer directive for FAAs to assist applicants with unusual circumstances to adjust their dependency status on the FAFSA form to reflect students’ situations more accurately (dependency overrides). Like other professional judgments, institutions must inform students of their ability to request an adjustment for unusual circumstances by publicly posting the option on their website. AnFAAmayconductdependencyoverridescase-by-caseforstudentswithunusualcircumstances.IftheFAA determinesthatanoverrideisappropriate,theymustmaintainthedeterminationwithanysupporting documentation. Dependencyoverrides UnderHEASec.480(d)(9),theFAFSASimplificationActincorporatedadditionalunusualcircumstancesto consider whenastudentcannotcontactaparentorwherecontactwithparentsposesarisktosuchstudent. Unusualcircumstancesdoinclude: ● Human trafficking, as described in the Trafficking Victims Protection Act of 2000 (22 U.S.C. 7101 et seq.); ● Legallygrantedrefugeeorasylumstatus; ● Parentalabandonmentorestrangement;or ● Studentorparentalincarceration. Unusualcircumstancesdonotinclude: ● Parentsrefusetocontributetothestudent’seducation. ● ParentswillnotprovideinformationfortheFAFSAorverification. ● Parentsdonotclaimthestudentasadependentforincometaxpurposes. ● Thestudentdemonstratestotalself-sufficiency. Anaidadministratormayoverrideonlyfromdependenttoindependent(though,assuggestedearlier,ifan independentstudentreceivessubstantial support from others, a school may use PJ to adjust the COA or FAFSA data items, such as untaxed income). CALGRANT Gurnick Academy of Medical Arts is a Cal Grant-eligible institution. The California Student Aid Commission offers state-funded grants to students. Students who would like to be considered for this grant must complete a FAFSA by the deadline published annually in the FAFSA and may also need to submit a GPA Verification to the California Student Aid Commission. For moreinformationabouttheCalGranteligibilityrequirements,visit https://www.csac.ca.gov/students GeneralCalGrantEligibility Requirements All Cal Grant applicants must: ● BeCaliforniaresidents. ● BeU.S.citizensoreligiblenon-citizens. ● AttendaneligibleCalifornia-qualifying post-secondary institution. ● Beenrolledatleasthalf-time. ● Maintainsatisfactoryacademicprogressasdefinedattheschoolofattendance. ● Havefamilyincomeandassetsbelowtheestablishedceilings. ● Notbeindefaultonanystudentloan. ● Notoweanyfederalorstategrantrefund. 103

Gurnick AcademyofMedicalArtsiseligibleforthefollowingCalGrants: Cal Grant A Cal Grant A provides tuition and fee assistance for low and middle-income students. For Cal Grant A, your courseworkmustbeatleasttwo(2)academicyears. Cal Grant B Cal Grant B provides low-income students with a living allowance, tuition, and fee assistance. Awards for most first-year students are limited to an allowance for books and living expenses. When renewed or awarded beyond the first year, the award also helps pay tuition and fees. For Cal Grant B, your coursework must be for at least one (1) academic year. Cal Grant C Cal Grant C awards assist with tuition and training costs for occupational, technical, and vocational programs. Funding is available for up to two (2) years, depending on the length of the program. To qualify, you must enroll in an occupational, technical, or vocational program that is at least four months long at a vocational/career school. Even though a GPA is not required to apply for a Cal Grant C, you are still encouraged to submit yours becauseitcanonlyhelpyourchancesofreceivinganaward. Students who receive Cal Grants and withdraw from school must have a similar calculation to determine the portion of unearned Cal Grant funds. The portion of Cal Grant earned is based on a prorated calculation of hours earned compared to what is scheduled in the period. Further information is available at the Financial Aid Office. LOANENTRANCEANDEXITCOUNSELING Students who have never received a Federal Direct Subsidized or Unsubsidized Loan must complete Entrance Counseling before disbursing the loan(s). Online entrance counseling is available at www.studentaid.gov. Counseling must be completed in a single session and takes 20 to 30 minutes. Additional optional Financial Awareness counseling is also available on this website. PLUSCreditCounseling is required if the U.S. Department of Education has informed the parent applying for the PLUS Loan that they have an adverse credit history and the parent borrower has obtained an endorser or documented to the satisfaction of the U.S. Department of Education that there are extenuating circumstances related to their adverse credit history. PLUS Credit Counseling can be completed voluntarily at any time. If PLUS Credit Counseling is completed voluntarily and the parent borrower is determined to have an adverse credit history by the U.S. Department of Education within 30 days of PLUS Credit Counseling completion, the PLUS Credit Counseling requirement is considered fulfilled. Exit Counseling is required for all Federal Direct Subsidized and Unsubsidized Loan borrowers. The online exit counseling is available at www.studentaid.gov. Counseling must be completed in a single session and takes 20 to 30 minutes. Exit counseling should be completed shortly before the student graduates or ceases to be enrolled on at least a half-time basis. Students who withdraw without notice will be emailed exit counseling information and a link to the online exit counseling. You can have your federal student loans forgiven, canceled, or discharged in certain situations. That means you won’t have to repay some or all of your loan(s). The terms “forgiveness,” “cancellation,” and “discharge” mean essentially the same thing. Public Service Loan Forgiveness is the most common way people apply to have their 104

student loans forgiven. Please see the following links for more information: StudentLoanForgiveness|FederalStudentAid Public Service Loan Forgiveness (PSLF) Help Tool | Federal Student Aid STUDENTLOANCODEOFCONDUCT It is the policy of Gurnick Academy of Medical Arts to administer its student loan program in a manner that provides the maximum benefit to its student borrowers. To avoid even the appearance of impropriety, neither Gurnick Academy of Medical Arts nor any employee of Gurnick Academy of Medical Arts will solicit or accept any benefit from a student lending institution as consideration for any advantage provided to the lending institution concerning its educational loan activities. The following principles and prohibitions apply to the student loan program at Gurnick Academy of Medical Arts: 1. Gurnick Academy of Medical Arts shall not engage in any revenue-sharing arrangement with any student lending institution. 2. No employee of Gurnick Academy of Medical Arts shall accept anything of value from a student lending institution on their behalf. 3. No employee of Gurnick Academy of Medical Arts shall serve as a member or participant of a board of a student lending institution unless the participation is unrelated to educational loans or the employeehasnodirectinvolvementwithorbenefitsfromthefunctionsofthefinancialaidoffice. 4. No employee, representative, or agent of a student lending institution shall be authorized by Gurnick Academy of Medical Arts to be identified to the public as an employee, representative, or agent of Gurnick AcademyofMedicalArts. 5. No employee, representative, or agent of a student lending institution shall provide staffing services to Gurnick AcademyofMedicalArts’sfinancial aid office. Gurnick AcademyofMedicalArtsshallnotprovidealenderlistthat: 1. Is used to deny or impede a borrower’s choice of lender. 2. Contains the names of fewer than one student lending institution. 3. Includes student lending institutions that have benefited Gurnick Academy of Medical Arts or its student borrowers in exchange for inclusion on the list. Nolenderlistshall be provided unless it contains the following: 1. A disclosure in plain language of the process by which Gurnick Academy of Medical Arts selects student lending institutions for the lender list, including the method and criteria utilized and the relative importance of each criterion. 2. A clear statement that the borrower has the right and ability to select the educational loan provider of the borrower’s choice, is not required to use any of the lenders on the list and will suffer no penalty or unnecessary delay for choosing a lender not on the lender list. Inclusion on the lender list shall be determined solely by considering the borrower’s best interests. Any student 105

lending institution placed on the list shall assure Gurnick Academy of Medical Arts and borrowers that the advertised benefits upon repayment will continue to ensure the borrower’s benefit regardless of whether the lending institution’s loans are sold. The list shall not include any student lending institution that, to Gurnick Academy of Medical Arts knowledge after reasonable inquiry, has an agreement to sell its loans to another lending institution unless the agreement is disclosed. Favorable placement on the list shall not be provided to any student lending institution for a particular type of loan in exchange for benefits provided to Gurnick Academy of Medical Arts or its students in connection with a different loan type. The contents of any lender list shall be reviewed and updated at least annually. Gurnick Academy of Medical Arts shall inform student and prospective borrowers of all financing options available under Title IV of the Higher Education Act of 1965, including information on the terms and conditions of available loans under Title IV or State law that are more favorable to the borrower. Gurnick Academy of Medical Arts shall not direct, in any manner, potential borrowers to electronic promissory notes or other loan agreements that do not provide a reasonable and convenient alternative for the borrower to complete such documents with any federally approved student lending institution offering the relevant loan in this State. If you qualify for the Federal Direct Stafford Loans (Sub & Unsub), please be aware that the federal government charges a loan fee. The Federal Direct Stafford Loans are required by law to provide a range of flexible repayment options, including, but not limited to, income-based repayment (IBR) and income-contingent repayment (ICR) plans, and loan forgiveness benefits, which other student loans are not required to provide. Federal Direct Stafford Loans are available to students regardless of income. Private student loans are not federal student loans. Private loans are credit-based and may have a variable or fixed interest rate. Private student loans can offer variable interest rates that can increase or decrease over time, depending on market conditions. Private student loans have a range of interest rates and fees; students should determine the interest rate and any fees associated with the private student loan before accepting the private loan. The student should contact the private student loan lender if they have any questions about the private student loan. The private student loan interest rate may depend on the borrower’s credit rating. The student may choose any lender. SALLIE MAELOANS Sallie Mae is the only private education lender from whom Gurnick Academy of Medical Arts students have borrowed in the last three (3) years. Students and families can also check with their local banks or credit unions abouttheavailability of private education loans or other funding options. The Sallie Mae Smart Option Loan offers 1. Choosebetweenacompetitivevariableorafixedinterestrate. 2. Nooriginationfeesandnoprepaymentpenalty. 3. Apply with a creditworthy cosigner. A cosigner may help lower your interest rate — and give you a better chance of approval. 4. Lower your rate. Receive a 0.25% interest rate reduction while enrolled to make scheduled paymentsbyautomaticdebit. 5. Free Quarterly FICO® Credit Score. Borrowers with an eligible loan may receive their FICO ® Score quarterly. You’ll also receive access to the key factor(s) affecting your FICO ® Score and educational content to help you understand why monitoring it is essential. 106

For full information on Sallie Mae Student Loans, go to https://salliemae.com/student-loans. COLLEGEAVE College Ave is our newest lending partner. College Ave is a private student loan company known for its simple application, helpful tools, and customer service. TheCollegeAveCareerLoanoffers 1. 16possiblerepaymentcombinations,includingafixedorvariableinterestrate,repaymenttime,and repaymentoptionsrangingfromfulldeferraltoimmediaterepayment. 2. Noorigination fees and no prepayment penalty. 3. Applywithacreditworthycosigner. Acosignermayhelploweryourinterestrate andgiveyouabetter chanceofapproval. 4. Loweryourrate. Receivea0.25%interestratereductionwhileenrolledtomakescheduledpaymentsby automaticdebit. 5. Success Rewards. $150 credit towards the principal balance upon graduation from your program of study. 6. PayeeRewards.Cash-backrewardsprogramtowardspaymentofyourloan. TheCollegeAveParent/SponsorLoanoffers 1. Eligible Borrower. The borrower can be a parent or any creditworthy individual who would like to borrowonbehalfofthestudent. 2. Choosebetweenacompetitivevariableorafixedinterestrate. 3. Noorigination fees and no prepayment penalty. 4. Loweryourrate. Receivea0.25%interestratereductionwhenyouenrolltomakescheduledpayments byautomaticdebit. 5. PayceRewards.Cashbackrewardsprogramtowardspaymentofyourloan. LearnmoreaboutCollegeAveStudentLoansatwww.collegeavestudentloans.com. VETERANSBENEFITS&VETERANSADMINISTRATIONAPPLICANTSADDITIONAL INFORMATION Applications for Veterans’ benefits may be obtained by contacting the Veterans Administration. Approval of training benefits to be awarded is the responsibility of the Veterans Administration. Additional requirements are placed upon the institution and the applicant to achieve and maintain VA eligibility and utilize their VA benefits. Applicants eligible for VA benefits to Gurnick Academy of Medical Arts must comply with the items included in this section and all Gurnick Academy of Medical Arts institutional policies. Students may check their GI Bill® eligibility at http://gibill.va.gov. GI Bill® is a registered trademark of the U.S. Department of Veterans Affairs (VA). More information about education benefits offered by the VA is available at the official U.S. government website at http://www.benefits.va.gov/gibill. VAReviewofPriorTrainingforTransferCredit Before acceptance, any VA-eligible applicant must provide Gurnick Academy of Medical Arts an academic transcript or any other official documentation of all previous training. 107

Gurnick Academy of Medical Arts will review each submitted transcript or official documentation to determine if any prior training may be utilized as transfer credit into a program. Gurnick Academy of Medical Arts will documentthereviewinwriting,andacopyofthedeterminationwillbegiventotheapplicant. The transcripts or other official documentation, the written Gurnick Academy of Medical Arts review, and determination will become a part of the student’s official Gurnick Academy of Medical Arts academic record andsubjecttoallpolicies and regulations concerning academic records. VATransferCredit If transfer credit is granted to a VA-eligible applicant, the portion of the replaced program is not eligible for certification for VA benefits. The applicable part of the program substituted is not billable to the student, VA, or anyotheragency. VA-Specific Academic Requirements of Eligibility VA-eligible students must maintain Satisfactory Progress in their program to maintain benefits eligibility. Students not receiving a minimum grade of C in any course will be referred for remediation a maximum of three (3) times. VA Benefits will be terminated if the student is expelled from the program. For more information, please read our Academic Probation/Remediation policy in the Gurnick Academy of Medical Arts catalog. Additional Responsibilities for VA Eligible Applicants Gurnick Academy of Medical Arts does not determine any eligibility for VA benefits. The eligible applicant must complete all VA applications and requirements with the VA and receive VA approval before Gurnick Academy of MedicalArtsacceptsanyexpectedVAfundsaspartofatuitionpaymentplan. Receipt of VA Additional Notices The VA requires that all VA-eligible applicants receive a copy of the Gurnick Academy of Medical Arts Catalog, including the AddendumandGurnickAcademyofMedicalArtsdocumentssuchasdisclosures. MaximumTimeframe VA benefits are paid for 100% of the published program length and not up to 150% of the maximum timeframe. AIDDISBURSEMENT&SATISFACTORYACADEMICPROGRESS(SAP) All federal aid is paid in two disbursements over an award year. The first financial aid disbursement usually occurs within the first 30 (thirty) days of the program’s start date. Each disbursement after the first is contingent upon students meeting the Satisfactory Academic Progress (SAP) requirements. In addition, students must complete both the clock or credit hours and the weeks in the payment period to receive the subsequent disbursementinnon-termprograms. For term programs, SAP is monitored at the end of each term. In non-term programs, SAP measurements are completed attheendofeachpaymentperiodwhenthestudent’sclockorcredithourshaveelapsed,regardless of whether the student attended them. The Gurnick Academy of Medical Arts SAP policy is available at www.gurnick.edu/financial-aid/. Pell, FSEOG, IASG, Direct Loans, and PLUS Loans are disbursed once per pay period. Federal Work-Study funds must be earned as the student works and received as wages through the Gurnick Academy of Medical Arts payroll office. Cal Grants are disbursed by quarter; each grant comes in three (3) payments. Before a financial aid disbursement, the Financial Aid Advisor must check the student’s status to ensure that the student is not in LOA status. For PLUS loans, the Financial Aid Advisor will check the parent’s status with NSLDS to confirm that the parent is not in default nor owes a refund of federal grant funds before each disbursement. 108

ALLSTUDENTS MaximumTimeframe All students who receive financial aid must complete their program within 150 percent of the normal program length, as measured in either credit hours for term programs or calendar time for non-term programs. If they exceed the maximum timeframe, they are subject to the loss of financial aid, which can be appealed following theprocedureoutlinedbelow. Students who are academically expelled from one program and wish to transfer to another program at Gurnick Academy must submit a written appeal according to the terms outlined below. Admission to the new program requires the approval of the program director and the director of financial aid. If the appeal is granted, the student will be admitted to the new program on an Academic Plan status and must follow the terms of the academicplanprovidedtothem. AppealandReinstatement Students who have lost financial aid eligibility for failure to maintain satisfactory progress will be notified in writing of the cancellation of financial aid. Students with mitigating circumstances wishing to appeal the financial aid cancellation may do so in writing to the Financial Aid Office. Mitigating circumstances may include but are not limited to illness or injury of the student or immediate family member, death of a relative, or other special circumstances. The Director of Financial Aid and Campus Program Director will evaluate the appeal and determinewhetherthestudentmaycontinuereceivingfinancialaidonanAcademicPlanstatus. Thestudent’sappealmustincludethefollowing: 1) ThereasonwhythestudentfailedtomeettheSAPstandard(s)AND 2) Whathaschangedinthestudent’ssituationsothattheywillnowbeabletomeet theSAPstandardsAND 3) Supporting documentation, as applicable. If an appeal is granted and financial aid is reinstated, the student will receive aid on an Academic Plan status. A student with this status must regain SAP standing by the point specified in the academic plan; the terms will be included in the notice forwarded to the student when the appeal is granted. The terms will generally require students to meet or exceed the attendance requirements, pass all courses with a “C” or better, and may include additional elements needed, such as tutoring. The student’s progress will be reviewed each month based on the Academic Plan. At the end of the payment period, if a student fails to meet the requirements of the Academic Plan, they will become ineligible for financial aid. The Academic Plan is structured to assist the student in regaining SAP status by a projected time, generally staying within the maximum time frame. Students are limited to one appeal during their education at Gurnick Academy, regardless of the reason or other circumstances. If a student regains SAP status, they may appeal one (1) additional time. Credit Balance Refunds Therefundwillbeissued30daysfromthestartdateofthecreditbalanceonthestudent’saccount. TERM-BASEDPROGRAMS All withdrawals, incompletes, and repetitions are considered when determining Satisfactory Academic Progress. Incompletes and withdrawals are not considered as credits completed. Transfer credits are counted as attempted and earned credits but do not affect the GPA. Nontraditional awarding of credit, including credit by 109

exam and credit for life experience, is counted as both attempted and earned credits but does not affect the GPA. Satisfactory progress standards apply to all students, regardless of enrollment status (full-time, 3/4 time, 1/2time,orlessthan1/2time).Allcredithoursastudenthasincurredafinancialobligationareconsidered. Students are considered in good standing if they have at least a 2.0 cumulative grade point average (GPA) and meet the quantitative measure. The required pace or percentage of credit hours completed versus the attemptedhoursmustbeatleast67%.Accountabilitystartswiththestudent’sentrydateattheinstitution. Students who do not meet the required standards of SAP will receive a warning notice. While on a warning status, students are eligible to receive financial aid. Students still below standards for a second term will have their aid canceled. Students may appeal the loss of financial aid under the abovementioned appeal policy. All withdrawals and incompletes are considered when determining Satisfactory Academic Progress but do not impact the GPA. Courses for which a student has received a grade of Incomplete are counted as attempted but not completed. Transfer hours reduce the length of the scheduled program hours at Gurnick but do not impact theSAPmeasurements.Allhoursforwhichastudenthasincurredafinancialobligationareconsidered. NON-TERMPROGRAMS Students are considered in good standing if they have at least a 2.0 cumulative grade point average (GPA) at the scheduled end of each payment period (qualitative measure) and also meet the quantitative measure to ensure the student can graduate by the scheduled maximum timeframe, 150% of the program. The required pace or percentage of clock hours completed (quantitative measure) is determined as follows: A student must complete a minimum number of scheduled hours of each payment period that varies by program per the attendancepolicy. This information can be found in the chart below. Satisfactory Academic Progress is reviewed at the end of each payment period in all non-term-based programs, both clock and non-term credit hours. If a student does not meet the SAP requirements at the scheduled end of a payment period, the student’s financial aid eligibility is terminated, subject to appeal, as outlined in the policy above. NON-TERMPROGRAMSQUANTITATIVEMEASUREMENTCHART MINIMUMHRS HOURSINTHE PROGRAM TOBECOMPLETED PAYMENTPERIOD Theseprogramsareofferedinclockhours,andthepaymentperiodsaredefinedinclockhours. VN 442 450 XTMAS 442 450 AOSUT 442 450 AOSVUT 442 450 ASMRI 442 450 ASNM 442 450 ASPTA 442 450 AOSRT 442 450 ASRT 442 450 Theseprogramsareofferedincredithours,andthepaymentperiodsaredefinedincredithours. MA 16 18 DA 16 18 Disbursementsfornon-termprogramsaremadefollowingtheSAPevaluationandthedisbursementreview. Students must meettheSAPrequirementsandcompletetheclockorcredithoursandweeksinthepayment period for the scheduled disbursement to be made. 110

NON-TERMPROGRAMSMAXIMUMTIMEFRAMECHART WEEKSINTHE MAXIMUM PROGRAM PROGRAM TIMEFRAME(WEEKS) VN 52 78 XTMAS 52 78 AOSUT 96 144 AOSVUT 72 108 ASMRI 72 108 ASNM 94 141 ASPTA 44 66 AOSRT 94 141 ASRT 94 141 MA 30 45 DA 30 45 TERMPROGRAMSMAXIMUMTIMEFRAMECHART CREDITHOURS MAXIMUMTIMEFRAME PROGRAM IN THEPROGRAM ATTEMPTEDCREDITS ADN 80 120 ADN(LVNtoRN) 25 37 AOSRC 64 96 ASVN 33 49 BSN 120 180 BSN(LVNtoBSN) 63 94 BSN(RNBSN) 40 60 BSDMI 51 76 BSRT 131 196.5 MSN(BSNtoMSN) 36 54 ONLINESTUDENTS Students enrolling in an online program at Gurnick Academy of Medical Arts must first apply for admission at www.gurnick.edu/apply. Toreceivefinancial aid, students should: 1. Complete the FAFSA at www.www.studentaid.gov/h/apply-for-aid/fafsa or use the FAFSA mobile application. Use the Gurnick Academy of Medical Arts school code 041698. You will need an FSA ID to sign the FAFSA electronically; the website is www.studentaid.gov/fsa-id/create-account/launch. 2. The FAFSA results will be sent to you and Gurnick Academy of Medical Arts within a few days. Within two weeks of completing the FAFSA or adding the Gurnick Academy of Medical Arts’ school code, Gurnick Academy of Medical Arts will mail you an Estimated Financial Plan. This estimate will show you the anticipated grant and loan aid you may be eligible to receive, any balance you will owe, and paymentoptions. Can’t wait two (2) weeks? Call or email the campus financial aid office for an appointment. 111

3. Gurnick Academy of Medical Arts will process your FAFSA results and mail or email you a Requirements Letter with any additional requirements. This might include citizenship or eligible non-citizenship status documentation, tax returns, IRS transcripts, or other documentation. Gurnick Academy of Medical Arts cannotcontinuetoprocessyourfinancialaidawardswithoutalltherequireddocumentation. 4. Once the student has submitted all required documentation, Gurnick Academy of Medical Arts will mail or email a Financial Aid Plan. 5. To receive federal student loans, complete the Master Promissory Note (MPN), at www.studentaid.gov. First-time borrowers must complete student loan entrance counseling before the student starts, also at www.studentaid.gov. PLUS loans for parents of dependent students require a separate application and MPN, both available at www.studentaid.gov. 6. Students or parents can check with their local banks or credit unions if a private loan is necessary. Gurnick Academy of Medical Arts students have also borrowed private loans from Sallie Mae (www.salliemae.com). Students and parents should know that private loans have different terms than federal loans and generally have a higher interest rate. Federal loan eligibility should always be explored before borrowing a private loan. Students or parents who wish to speak with a financial aid advisor should contact the campus financial aid office by phone or email. RETURNOFNON-TITLEIVFUNDS Students who receive Cal grants and withdraw from Gurnick Academy of Medical Arts must have a calculation similar to the Return of Title IV calculation to determine the unearned portion of Cal Grant funds. The Cal grant portion earned is based on a pro-rata calculation of hours completed compared to those scheduled in the term. WITHDRAWALS&THERETURNTOTITLEIVAID(R2T4)CALCULATION TheU.S.DepartmentofEducationrequiresa“ReturnofTitleIVFunds”(R2T4)calculationforallrecipientsof federal financial aid who withdraw from school, officially or unofficially. This policy is separate from the institutional tuition refund policy described elsewhere in the catalog. The R2T4 calculation determines the proportion of Title IV funds the school and the student must return to the federal government and what amountscanberetainedonthestudent’saccount. Abrief description of the calculation follows. Please see the Financial Aid Office for further information or a moredetailedversionofthecalculation. 1. Thestudent’swithdrawaldate/lastdateofattendanceisdetermined. 2. The % of Title IV aid earned by the student is calculated as follows: Number of clock hours or scheduled days completed / Number of clock hours or scheduled days in the payment period = PercentageofTitle IV Funds Earned* *Thisratio is multiplied by the Title IV aid disbursed plus the Title IV aid that could have been disbursed to equal the Title IV aid earned. Total aid disbursed minus total aid earned equals the federal funds that must be returned to the aid programs. A student who has attended more than 112

60%ofthescheduledhoursordaysinthepaymentperiodhasfullyearnedtheTitleIVfunds disbursed for the payment period. 3. The amount of Title IV aid earned by the student is calculated: The ratio from above is multiplied by the total Title IV aid disbursed or that could have been disbursed to equal the amount of the Title IV aid earned. 4. A return is due if the aid disbursed exceeds the aid earned. A post-withdrawal disbursement is due if theaidearnedexceedstheaiddisbursed. 5. The school is responsible for returning the amount of unearned aid up to the unearned charges (charges for the payment period multiplied by the unearned % from above). 6. Any federal funds the school must return will be returned within 45 days of the determination that a student has withdrawn. Fundswill be returned in the following order: a) Unsubsidized Stafford Loans; b) SubsidizedStafford Loans; c) PLUSLoans; d) Pell Grants; e) FSEOG; f) IASG. Students are responsible for returning the balance of the unearned aid after subtracting the amount returned bytheschool.Thestudentreturnsloanfundsduringloanrepayment;theR2T4calculationwillshowanygrant fundsthestudentmustreturnimmediately.Studentswhodonotrepaytheamountofanygrantoverpayment are reported to NSLDS. The debt is referred to the U.S. Department of Education for collection. Students should be aware that Gurnick Academy of Medical Arts’ return of funds to the federal government as required by the R2T4 calculation may result in a higher balance due to the school from the student. ADMINISTRATIVEPOLICIES CATALOGPOLICIES Policies governing student conduct, admissions, prerequisites, graduation requirements, fees, course structures, duration of the subjects and courses, time of program offerings, and other aspects of this institution’s operations are subject to change. Changes in the content of this catalog will be added to the Catalog Addendum and postedonwww.gurnick.edu/school-catalog/.Together,theCatalogandtheAddendum represent current and updated information. Wereservetherighttoadopt,amend,orrepealallGurnickAcademyofMedicalArtspolicies.Thiscatalogdoes not constitute a contract or enrollment agreement. It also does not constitute a statement of the contract conditions between the student and Gurnick Academy of Medical Arts. Applicable state and education codes, state regulations, and Gurnick Academy of Medical Arts policies govern the individual student’s relationship to theInstitution. A catalog copy will be provided to each student before signing an enrollment agreement. Copies of the catalog can also be located at the front desk at each campus and on the Gurnick Academy of Medical Arts website, www.gurnick.edu. PROGRAMPOLICIES Academy policies cover all programs and courses at Gurnick Academy of Medical Arts. However, programmatic 113

Student Handbooks explain program-specific particulars and guidelines in greater detail. Many of our programs haveStudentHandbookswithprogrammaticrulesandregulations(subjecttochangewithoutnotice).Students must read and understand all programmatic rules and regulations in addition to the Gurnick Academy of MedicalArtsCatalogandAddendum. INDIVIDUALRESPONSIBILITY Each Gurnick Academy of Medical Arts student, staff, and faculty member is responsible for being familiar with the Gurnick Academy of Medical Arts policies and regulations published in this catalog. The Gurnick Academy of Medical Arts Catalog is disclosed to each individual before their enrollment at Gurnick Academy of Medical Arts. All students, staff, and faculty members must sign the receipt of disclosures acknowledging that they understandandagreetoabidebyallthepoliciesstatedinthiscatalog. ACADEMICFREEDOM Gurnick Academy of Medical Arts is committed to assuring its faculty full academic freedom. Confident in the qualifications and expertise of its faculty members, Gurnick Academy of Medical Arts encourages its faculty members to exercise their judgments regarding the organization of topics and instructional methods. The program-specific governing body approves the content. Instructors are encouraged to develop teaching methodsthatpromotestudentsuccess. Gurnick AcademyofMedicalArtsbelievesthatdiversityofthoughtresultingfromthefreeandopenexpression of viewpoints and opinions and the free exercise of research and original thinking in the academic fields related to course offerings benefit students. Gurnick Academy of Medical Arts supports and encourages instructors and students to engage in discussion and dialog. Students and faculty members are encouraged to freely express viewstounderstandthespecializedknowledgeofthestudieddiscipline. NON-DISCRIMINATION Gurnick Academy of Medical Arts is committed to providing equal opportunities to all applicants. No discrimination shall occur during Gurnick Academy of Medical Arts programs or activities. This includes activities related to the solicitation of students or employees based on race, color, religion, religious beliefs, national origin, sex, sexual orientation, marital status, pregnancy, age, disability, veteran’s status, or any other classification that precludes a person from consideration as an individual. Please direct inquiries regarding this policy to a Campus Director responsible for ensuring this policy is followed. Employees may refer to the Gurnick AcademyofMedicalArts’EmployeeHandbookformoredetails. Harassment/Title IX Coordinator “No person in the United States shall, based on sex, be excluded from participation in, be denied the benefits of, or be subjected to discrimination under any education program or activity receiving Federal financial assistance.” (Title IX, Education Amendments of 1972, Title 20 U.S.C. Sections 1681) Gurnick Academy of Medical Arts has designated Title IX Coordinators on each campus to oversee the institution’s compliance with all State and Federal discrimination laws, particularly sex discrimination. These Gurnick Academy of Medical Arts staff members function as Title IX Coordinators and primary function. Please note that the Title IX Coordinator function is associated with the title(s), as the designee’s name may change at anytime. 114

Concerning any questions, concerns, or grievances, students should contact the Campus Director for which they are enrolled. The Campus Director, or their official designee, functions as the Title IX Coordinator for each campus. The designated Title IX Coordinators will ensure compliance in all areas and aspects of Gurnick Academy of Medical Arts while facilitating any discrimination grievance procedures. This designee will also keep all records affiliated with discrimination grievances. They will be trained to investigate and conduct hearings in a manner that “protects the safety of victims” and “promotes accountability.” With this responsibility, the designee is considered a resource to Gurnick Academy of Medical Arts students and a resource for the faculty and staff. Sexual Harassment Gurnick Academy of Medical Arts is committed to providing a work environment free of discrimination, intimidation, and harassment. Maintaining this commitment, we believe it is necessary to affirmatively address this subject and express our strong disapproval of sexual harassment. No associate within Gurnick Academy of Medical Arts may engage in verbal abuse of a sexual nature, use sexually degrading or graphic words to describe an individual or an individual’s body or display sexually suggestive objects or pictures at any campus. Students are responsible for conducting themselves consistently with spirit and intent. Anti-Bullying/Anti-Harassment Gurnick Academy of Medical Arts believes individuals, including students, employees, and applicants, are entitled to a safe, equitable, and harassment-free experience. Bullying and harassment will not be tolerated andshall cause disciplinary action and law enforcement intervention. “Bullying” and “harassment” are defined as a pattern of aggressive, intentional, or deliberately hostile behavior that repeatedly occurs over time. These behaviors usually fall into three (3) categories: physical, emotional, and verbal. They may include but are not limited to intimidation, assault, extortion, verbal or written threats, teasing, put-downs, name-calling, threatening looks, gestures or actions, rumors, false accusations, hazing, social isolation, and cyber-bullying. Such behavior is considered bullying or harassment on or off Gurnick AcademyofMedicalArtsproperty. Any student, employee, or applicant who believes they have been or is the victim of bullying or harassment should immediately report the situation to the Gurnick Academy of Medical Arts administrator or another trusted institution employee responsible for reporting it to the appropriate authority. Gurnick Academy of MedicalArtsadministration will investigate reported incidents promptly and thoroughly. Advising, corrective discipline, and referral to law enforcement will be used to change the perpetrator’s behavior and remediate the impact on the victim. This includes appropriate intervention(s), restoration of a positive climate, and support for victims and others impacted by the violation. False reports or retaliation for harassment,intimidation, or bullying violate this policy. Sexual Assault Prevention and Response Gurnick Academy of Medical Arts educates the student community about sexual assaults and date rape through orientation. Upon request, the Police Department offers sexual assault education and information programs to students and employees. Literature on date rape education and risk reduction is available through theCampusDirector/Administrator. Gurnick Academy of Medical Arts is committed to creating and maintaining an educational environment where 115

respect for the individual is vital. Gurnick Academy of Medical Arts does not tolerate sexual assault in any form. The definition of “sexual assault” includes but is not limited to sexual battery, the threat of a sexual assault, and rape, including but not limited to forced oral copulation, foreign object, or sodomy. Statement of the StandardofEvidence:GurnickAcademyofMedicalArtsusesapreponderanceoftheevidencestandard. Sanctions Gurnick Academy of Medical Arts May Impose Following a Final Institutional Disciplinary Determination of Rape, Acquaintance Rape, Domestic Violence, Dating Violence, Sexual Assault, Stalking, or OtherSexualOffense: Sexual assaults violate the standards of conduct expected of every member of Gurnick Academy of Medical Arts. Sexual assault is a criminal act that subjects the perpetrator to criminal and civil penalties under state and federal law. Gurnick Academy of Medical Arts will abide by and cooperate with local, state, and federal sanctions in all cases. Gurnick Academy of Medical Arts disciplinary action may include expulsion depending on the seriousness of the situation. Gurnick Academy of Medical Arts will review the victim’s academic standing after a sex offense or alleged sex offense if those changes are requested and reasonably available. Gurnick Academy of Medical Arts will investigate the sexual assault allegations in which the accuser and the accused are entitled to the same opportunities to have others present during an institutional disciplinary proceeding, including the opportunity to be accompanied to any related meeting or proceeding by an advisor of choice. Students who have allegedly violated the code of conduct or been accused of sexual harassment or other Title IX violations may request a hearing by the Student Disciplinary Panel. The panel comprises the Title IX Coordinator, the Director of Financial Aid, and the Program Director. A faculty member may substitute for one of the panel members as necessary. The complaining student will be asked to write their allegations, and a copy will be provided to the alleged perpetrator. A hearing will be held within two (2) weeks of receipt of the allegations, and the panel will hear fromthecomplainantandtheallegedperpetratorseparately.Bothpartiesmayhaveanyonepresentwiththem for the hearing, including an advisor of their choice. The panel may call other students or employees as needed. The accuser and the accused must be notified simultaneously and in writing of the outcome of the proceeding, appeal procedures, any change to the result before it becomes final, and when the result becomes final. The parties will be provided the determinations concurrently. If another action is taken, and the alleged perpetrator remains in school, the complainant may request a transfer to another program start or shift as a protective measure.Thepanelmayalsoconsideratransferoftheallegedperpetratortoanotherprogramstartorshift. Gurnick Academy of Medical Arts may impose sanctions following a final determination of a disciplinary proceeding regarding rape, acquaintance rape, or other forcible or non-forcible sex offenses. Penalties for students can be up to expulsion from Gurnick Academy of Medical Arts. Appropriate action will be taken against employees per the Gurnick Academy of Medical Arts policies in the Employee Handbook. The disciplinary action imposed by Gurnick Academy of Medical Arts will not be in place of penalty, fines, or imprisonmentimposedbythelegalsystem. The victim’s confidentiality will be protected, including record-keeping that excludes personally identifiable information on victims. Gurnick Academy of Medical Arts will take all reasonable steps to investigate and respond to the complaint commensurate with the complainant’s request for confidentiality or termination of investigative pursuit. 116

The school will inform the complainant that its ability to respond may be limited should a complainant insist that their name or other identifiable information not be disclosed to the alleged perpetrator. Title IX prohibits retaliation, and school officials will take steps to prevent retaliation and take decisive action if it occurs. ReportingaSexualAssault Dial 9-1-1 should a sexual assault occur. If the victim cannot contact the authorities, please report this assault to any Instructor or Staff member who will contact the authorities on your behalf. While waiting for medical and law enforcement to arrive, although difficult, try to make mental notes of the incident so there can be as much detail as possible while reporting this assault to the local police. Be certain to request medical treatment. If the incident occurred on campus, the victim must report the assault to any Faculty/Staff member or Academy Director. Although sexual assault is a criminal offense, police will not collect evidence of a personal nature from the victim’s body. After the sexual assault, it is imperative to receive a medical examination by trained personnel for a full physical exam before showering, changing clothes, or bathing, as preserving the evidence is imperative. Victims may notify and seek assistance from law enforcement and campus security authorities. Counseling The survivor of a sexual assault is urged to seek counseling shortly after the sexual assault. Victims of sexual assault may receive FREE CONFIDENTIAL 24-HOUR counseling by calling RAINN (Rape Abuse Incest National Network) HOTLINE NUMBER 1-800-656-HOPE (4673). Trained counselors are available at the number mentioned above, 24 hours a day, seven (7) days a week. RAINN can also be reached 24/7 through online chat at hotline.rainn.org/online/. You can find more information at www.rainn.org. SexOffenderRegistry Gurnick Academy of Medical Arts is providing a link to the National Sex Offender Registry following the “Campus Sex Crimes Prevention Act” of 2000, which amends the Jacob Wetterling Crimes Against Children and Sexually Violent Offender Registration Act, the Jeanne Clery Act, and the Family Educational Rights and Privacy Act of 1974. This act requires higher education institutions to issue a statement advising the campus community where law enforcement information concerning registered sex offenders may be obtained. It also requires sex offenders already required to register in a State to provide notice to each institution of higher education in that State at which the person is employed, carries a vocation, or is a student. TheCalifornia Department of Justice’s website lists designated, registered sex offenders in California: www.meganslaw.ca.gov. The following website offers a link to all registered sex offenders that are searchable either by name or by zip codewithinaradiusofacertainaddress:www.familywatchdog.us. STUDENT’SRIGHTTOPRIVACY Gurnick Academy ofMedicalArtscomplieswithTheFamilyEducationalRightsandPrivacyActof1974(FERPA), commonly called the Buckley Amendment. This act provides Gurnick Academy of Medical Arts students and their parents with rights involving access and release of personally identifiable records. Gurnick Academy of Medical Arts departments maintain student records. Personally identifiable information from these records may not be disclosed to a third party without the eligible student’s written consent. 117

Notwithstanding the above, disclosure to Gurnick Academy of Medical Arts administration and faculty members with a legitimate educational purpose in seeing the records is permitted. Release of records to regulatory bodies, accrediting bodies, oversight bodies, and legally executed court subpoenas does not require student or parent release. Gurnick Academy of Medical Arts may release directory information without the student’s permission unless thestudentstates, in writing, within the first two (2) weeks of the program, the specific information they desire nottobeincludedaspartoftheirdirectoryinformation.Directoryinformationconsistsofthefollowing: ● Student’sname ● Hometown ● Classlevel ● Registeredcredits(currentterm) ● Majorfieldsofstudy ● Participationinrecognizedactivities and sports ● Biographicdataforpublicrelationspurposes ● Diplomasandawardsreceived ● Mostrecentpreviouseducationalinstitution(s)attended ● Veteranstatus ● Jobplacementinformation. Students who wish to disclose information must complete a Gurnick Academy of Medical Arts FERPA Release Formatwww.gurnick.edu/student-forms/. Any student or employee who engages in conduct that directly or indirectly violates or infringes upon the privacy rights of an employee or student will be subject to disciplinary action, including expulsion/termination fromGurnickAcademyofMedicalArts. STUDENTRECORDS Gurnick AcademyofMedicalArtsmaintainsstudentrecordsinindividualfoldersaccordingtoprivacy regulations. Student folders are started for each future student during Gurnick Academy of Medical Arts registration and contain all required documents according to BPPE and ABHES. The student folder will also contain documentssuchasasummarystatementofthestudent’sprogress,refundcalculation,andacopyof therefund(if applicable) should a student withdraw/be expelled before program completion/graduation. After program completion, all official information (copy of transcripts, a record of clinical performance, lab experiments, and program completion) will remain on file, on-site, for at least two (2) years. After two (2) years following program completion, all students’ information in hard-copy format will be archived into electronic formatandkeptonanoffsitecomputerserverforatleastfive(5)years.Transcriptswillbemaintained indefinitely. Students must make archived copies of all vital documentation throughout their training. All hard-copyrecordsarestoredinlocked,fireproofcabinets. Gurnick AcademyofMedicalArtsmaintainsstudenttranscriptspermanently. Informationontranscripts includes the following: ● Coursesoreducationalprogramsthatwerecompletedorwereattemptedbutnotcompleted,andthe dates of completion or withdrawal; ● Thefinalgradesorevaluationsgiventothestudent; ● Creditforcoursesearnedatotherinstitutions; ● Creditbasedonexperientiallearning; ● Creditbasedonadvancedplacement; 118

● Degreeorcertificateawardedtothestudent;and ● Theinstitution’sname,address,emailaddress,andtelephonenumber. If a student withdraws before graduation, a summary statement of the student’s progress, refund calculation, andacopyoftherefund(ifapplicable)willbeplacedinthefolder.Thisfolderwillbetreatedasdescribed above. Students mayinspecttheirmasterfileatanytimeunderthedirectsupervisionoftheProgram Director/Coordinator or an authorized staff member. Should a student find, upon the review, that there are inaccurate or misleading records, the student may request that errors be corrected. If a difference of opinion exists regarding mistakes, the student may ask for a meeting with the Program Director or Coordinator to resolve the matter. All student records are confidential and will only be given to authorized persons. Data such as grades, Registry andStatecertification examination scores, health records, and performance evaluations may only be revealed with the student’s consent. Only authorized personnel will have access to in-progress student evaluations and files. TRANSCRIPTS Each student’s folder contains the student’s academic progress record and evidence of diplomas issued by Gurnick Academy of Medical Arts. Official transcript requests will be granted upon payment of a fee of $15.00. Transcripts will only be released upon the student’s written and signed request. Kindly note that transcripts maynotbeavailableimmediatelyastheyareprocessedthroughtheRegistrarattheCorporateoffice. STUDENTCODEOFCONDUCT Students shall always conduct themselves professionally and ethically. Students are expected to conduct themselves within the bounds of acceptable behavior and appearance, as defined in this catalog and the judgment of Gurnick Academy of Medical Arts personnel. No profanity is tolerated in the patient care areas, campus, orclassroomenvironments.Insubordinationtofacultyandclinicalinstructors or dishonesty could be a reasonforimmediateexpulsionfromtheprogram. In addition to being expected to follow the rules and regulations established by the program and clinical facilities, students are expected to follow the Standard of Ethics and act under the American Hospital Association’s Patient’s Bill of Rights. All students are expected to respect the rights of others and are held responsible for conforming to the laws of the national, state, and local governments and conducting themselves in a manner consistent with the best interests of Gurnick Academy of Medical Arts and the student body. Gurnick Academy of Medical Arts reserves theright to expel a student for any of the following reasons, including but not limited to ● Failuretomaintainsatisfactoryacademicprogress ● FailuretopayGurnickAcademyofMedicalArtsfeesortuitionbyapplicabledeadlines o Any unpaid tuition, fees, and supplies balance becomes due and payable immediately uponastudent’sexpulsionfromGurnickAcademyofMedicalArts. ● Disruptive behavior threatens students’ and Gurnick Academy of Medical Arts’ community members’healthandwelfare. ● Unlawful possession, use, distribution, or attempted unlawful possession, use, or distribution of drugsandalcohol. 119

● Destructionordamagetopersonalorschoolproperty. ● Recklessdrivingorparkingviolationsoncampus. ● Hazingofstudentsorinitiationthatisdangerous,harmful,ordegrading. ● Distribution or obstruction of instruction, classroom activity, research, administrative activity, or other school activity on campus. ● Forcefulorillegalentryintoanareaoftheschoolproperty. ● Cheatingorstealing. ● Illegal activities or other actions deemed inappropriate by the Director. ● Distributing or posting materials, publications, leaflets, or other printed materials without prior permission from the school administration. ● Possessionoffirearms,fireworks,explosives, or any other weapons. ● Falsealarmsorthreats. ● SexualHarassmentofanykind. ● FailuretocomplywiththeGurnickAcademyofMedicalArtspoliciesandprocedures. SAFETY&CAMPUSSECURITY The following policies have been adopted to comply with the requirements of the Campus Security Act (34 CFR 668.46). Access Through approved access control, Gurnick Academy of Medical Arts campuses will be open to students, employees, contractors, guests, and invitees during business hours. Access to all Gurnick Academy of Medical Arts facilities is through the Verkada Pass application for students and staff and through a key fob for contractors, temporary personnel, and visitors. CampusResidences Gurnick AcademyofMedicalArtsdoesnothavecampusresidences. CampusPoliceAuthorityandJurisdiction Security personnel hired by Gurnick Academy of Medical Arts have the authority to ask all people on the premises of Gurnick Academy of Medical Arts for identification and to determine whether those individuals have lawful business at Gurnick Academy of Medical Arts. Security personnel do not possess arrest power. Criminal incidents are referred to the local police, who have jurisdiction on the campus. CrimePreventionPrograms Gurnick Academy of Medical Arts does not have a crime prevention program. In addition, Gurnick Academy of Medical Arts does not have any off-campus student organizations that require monitoring of criminal activity off campus. Security Awareness Programs During initial enrollment, students are informed of services offered by Gurnick Academy of Medical Arts. Students are told about crime on campus. Similar information is presented to new employees during new hire orientation. Gurnick campuses create and maintain an EPP (Emergency Response Plan) as a guide for emergencies. Students and staff may access the EPP in the lobby of each campus. Campuses also practice emergency response protocols quarterly. Periodically, as determined to be needed, presentations or materials may be 120

provided on crime prevention awareness, sexual assault prevention, drug and alcohol abuse, theft, and vandalism, as well as educational sessions on personal safety. A common theme of all awareness and crime prevention policy programs is to encourage students and employees to be aware of their responsibility for their security and the security of others. Information is disseminated to students and staff through the Campus Security Policy and orientation. When time is of the essence, information is released to students and employees of Gurnick Academy of Medical Arts. TimelyWarnings If a situation on or off campus arises that constitutes an ongoing or continuing threat in the judgment of the Campus Director, a campus-wide “timely warning” will be issued. Timely warnings and emergency notifications are evaluated continuously every time a crime log is completed. If a crime log has not been filled out for more than12months,thenasimulationofdifferentscenariosisusedtoevaluatetheprocess. Procedure: When a determination has been made that a timely warning should be issued, Gurnick Academy of Medical Arts will inform the campus community by taking one or more of the following steps to ensure timely notification. Thewarningwillbeissuedtofaculty,staff, and management: ● ClassAnnouncements ● Campus-wideemailofthetimelynoticeissued ● Warningfliersdistributedaroundthecampus ● Websitewarningposted ● AlertthroughVerkadasecuritysystem ● Campus-wideintercom/loudspeaker Such warning(s) may include but are not limited to the type of crime, the date and time, the location, and any suspect information. Anyone with information that warrants a timely warning should report the circumstances to the Campus Director by phone or in person. The victim’s names will be withheld when following the procedure described above. AnnualDisclosureofCrimeStatistics Gurnick Academy of Medical Arts prepares this report to comply with the Jeanne Clery Disclosure of Campus Security Policy and Crime Statistics Act. The full text of this report can be located at www.gurnick.edu. This report is prepared with the local law enforcement agencies surrounding our campus. Each entity provides updatedinformationonitseducationaleffortsandprogramstocomplywiththeAct. Campus crime, arrest, and referral statistics are reported to Gurnick Academy of Medical Arts. These statistics may also include crimes in private residences or businesses and are not required by law. California law (11160 of the California Penal Code) requires prompt, mandatory reporting to the local law enforcement agency by healthcare practitioners when they provide medical services to a person they know or reasonably suspect is suffering from wounds inflicted by a firearm or is a result of assaultive or abusive conduct. Each year, an e-mail notification is made to all at Gurnick Academy of Medical Arts with the web address to access this report. 121

CrimeReporting Prompt reporting will ensure timely warning notices on campus and timely disclosure of crime statistics. Gurnick Academy of Medical Arts does not have campus police. All crime victims and witnesses are strongly encouraged to report the crime immediately. If a crime or other emergency occurs, students are instructed to notify any staff/faculty member of Gurnick Academy of Medical Arts, including the Security personnel if applicable. They will place the 911 call. If the nature of the emergency makes this impossible, the students should call 911 themselves. Contact the appropriate Campus Director for non-emergencies. This information is postedontheGurnickAcademyofMedicalArtspremisesinseveralconspicuousplaces. Confidential Reporting Gurnick AcademyofMedicalArtsdoesnotallowconfidentialreporting.Allreportswillbeinvestigated.Gurnick Academy of Medical Arts does not have procedures for voluntary, confidential crime statistics reporting. Violations of the law will be referred to law enforcement agencies and, when appropriate, to the Campus Director for review. When a potentially dangerous threat to the Gurnick Academy of Medical Arts community arises, timely reports or warnings will be issued. Please see the Timely Warnings Policy above for more information. Procedures All individuals at Gurnick Academy of Medical Arts premises are encouraged to promptly report crimes and public safety-related incidents to the Campus Director. The Campus Director will investigate a report when it is deemed appropriate. If assistance is required from the local Police Department or Fire Department, they will contact the proper unit. If a sexual assault or rape should occur, the Campus Director on the scene will offer the victim assistance after calling 911. This publication contains information about on-campus and off-campus resources available if a crime happens. The information about “resources” is not provided to infer that such resources are “reporting entities” for Gurnick AcademyofMedicalArts. Personal Property Gurnick Academy of Medical Arts does not assume responsibility or is held liable for any loss, damage, or theft of students’ personal property. This includes but is not limited to clothing, jewelry, electronic devices, school materials, credit cards, checks, cash, or cash equivalent. All personal property is the student’s sole responsibility. It is strongly recommended to avoid bringing valuable items when attending class on campus or in a clinical environment. Students bringing any valuable belongings to school do so at their own risk. Incident/Accident Reporting All accidents/incidents, including those occurring on Campus/Clinical Site premises, resulting in personal injury or illness, shall be promptly reported and investigated. If the injury or illness requires emergency medical treatment, call 911 for proper notification of emergency services. Management must complete an Incident/Accident Report form in all cases requiring first-aid treatment, emergency services, or any incident that can develop into an injury or illness. If students/faculty are involved, their Program Coordinator should be notified. If staff is involved, their appropriate supervisors must be notified. In all cases, Campus Directors and management must be notified whenever an Incident/Accident Reportformiscompleted.Thesereportsarethenfiledintherespectiveindividual’sphysicalfolder. AnIncidentReportmustbecompletedinfull,describingthefollowing: ● Incident circumstances, including the date and time of the incident/accident, details of the procedure being performed, including where and how the incident/accident occurred, and if there 122

was an exposure related to a sharp device, the type of device, and how and when while handling thedevicetheincident/accident occurred. ● Details of the incident/accident, including if there was an exposure to blood or bodily fluids and information about the exposure source (i.e., whether the source material contained HIV or other bloodborne pathogens), and if the source is an HIV-infected person, the stage of disease, history of antiretroviral therapy, and viral load if known; Attempt to persuade the source person to make themselvesavailable for bloodborne pathogen testing, pre-test counseling, and form completion. ● Detailsaboutthefollow-up. ● List all parties involved, and ensure the form is signed by all relevant parties and returned to ProgramCoordinators/Directors immediately. ● Keepaffected parties’ privacy rights in mind if/when sharing information regarding the incident and report (E.g., do not scan the report and keep it in an open network folder). The student is expected to utilize common sense in patient-care procedures and those OSHA policies related to bloodborne pathogens that minimize risks to the student and, if pregnant, to the unborn fetus. If a student has an incident involving contact with bloodborne pathogens, they are expected to follow the affiliate’s exposure control policies. The student’s responsibility is to see their physician immediately to establish baseline testing and seek any required follow-up. If all procedures mentioned above are not adhered to, supervisors must be promptly notified. Additionally, if the incident occurred on the premises of any Clinical Facility/site, the student and instructor should complete the Incident/Accident Report Form, and any concerns where processes are incongruent with this procedure should be noted. Similarly, our clinical affiliations can file an Incident Report if students do not adhere to proper procedures. More details regarding needle sticks, the incident/accident reporting of needle sticks, and exposure to blood/bodily fluids are detailed in the Needle Stick Policy. WeaponsandFirearms The possession, manufacture, transfer, sale, storage, display, or use of weapons of any kind, including, without limitation, firearms, while on property owned, leased, or under Gurnick Academy of Medical Arts’ control or while at a clinical site, regardless of whether the person is licensed to carry the weapon, is strictly prohibited. Failure to abide by this policy will result in disciplinary action, including expulsion from Gurnick Academy of MedicalArts. NeedleStick Healthcare professionals may be exposed to blood and bodily fluids. Bloodborne pathogens such as Hepatitis B, Hepatitis C, and HIV can be severe, even life-threatening. If exposure to blood or bodily fluids occurs, Gurnick AcademyofMedicalArtsstudents,faculty,andstaffmembersshouldfollowthispolicy. Wounds and skin sites that have been in contact with blood or body fluids should be washed with soap and water; mucous membranes should be flushed with water. Applying caustic agents (e.g., bleach) or injecting antiseptics or disinfectants into the wound is not recommended. ● Rinsetheareawithcleanwater,saline,orothersterileirrigatingsolution. ● Reporttheincidenttotheclinicalsitesupervisor,departmentsupervisor,clinical instructor, etc. ● Follow-up is indicated if it involves direct contact with a bodily fluid listed above and there is evidenceofcompromisedskinintegrity(e.g.,dermatitis, abrasion, or open wound). 123

● The exposed individual should be evaluated for susceptibility to bloodborne pathogen infections. Baseline testing (i.e., testing to establish serostatus at the time of exposure) for Hepatitis B, Hepatitis C, and HIV antibodies should be performed. ● Individuals exposed to Hepatitis B, Hepatitis C, or HIV should receive follow-up counseling, post-exposure testing, and medical evaluation. HIV-antibody testing should be performed for at least six (6) months post-exposure. ● An Incident Report must be completed in full. Please see the Incident Accident Reporting policy above. Use safer needle and needleless devices to decrease needle sticks or sharps exposures. Properly handle and dispose of needles and other sharps per the Bloodborne Pathogens Standard. You must utilize your training, protective clothing, and equipment and remain vigilant to signs, labels, and other provisions. CommunicableDisease Students with known communicable diseases must follow the clinical site’s infectious disease protocols. Gurnick Academy of Medical Arts has no jurisdiction over a clinical facility’s infectious disease protocol. However, the student must report illness, infectious diseases, and any condition affecting the student’s health, patients, or clinical staff. This should be reported to a program official or clinical instructor. All students must meet safe health standards to protect clinical personnel and safeguard patients. Any student with an elevated temperature (100 degrees F. or more orally), symptoms of urinary infection (dysuria, urgency, or frequency), symptoms of respiratory infection, symptoms of gastrointestinal infection, or symptoms of pink eyemustreporttheconditiontoaprogramofficialorclinicalinstructor,evenifunderaprivatephysician’scare. The program official or clinical instructor reports the condition to the Infection Control Department at the clinical site. Before the student returns to the program, the student’s physician must verify a clean bill of health status. The student is responsible for making up lost clinical time and missed classwork during their absence. Radiography students take part in invasive procedures. Students with known latex sensitivity or allergies should knowthatGurnickAcademyofMedicalArtscannotguaranteenon-exposuretolatexintheclinicalarena. During student experiences in the clinical setting, the student may encounter diseases, equipment, and treatments that may be hazardous to the individual and an unborn fetus. TB exposure should be followed immediately with another Mantoux and a three (3) month follow-up. A copy of the incident should be sent to theGurnickAcademyofMedicalArtsadministration. If the student comes into contact with diseases outside the program or contracts diseases that may be hazardous to other students, patients, or hospital personnel, it must be reported to the appropriate program director immediately. A decision will then be made individually regarding the future of the student’s participation in the program. A student who mayhavebeenexposedtoacommunicablediseasemaybeaskedtoleavetheclinicalareauntil theincubationperiodhasexpired.Anymissedclinicalhoursmustbemadeuplaterifastudentisabsent. Federal Law Concerning Chemical Hazards Federal law requires that all individuals be notified about hazardous chemicals present in the workplace. This law applies to all occupations with the fundamental purpose of raising the level of consciousness on chemical safety. 124

Chemical suppliers must prepare Safety Data Sheets (SDS) for all chemicals used in radiology. Photographic chemicals are used in radiology for processing x-ray films. Some of these chemicals must be used with more than routine precautions. Photographic chemicals can cause allergic reactions or irritate the skin with repeated or prolonged contact. The use of gloves can minimize skin contact hazards. MSDS should be available at all clinical facilities upon request. DRUG-FREE Drug-FreeCampus Gurnick AcademyofMedicalArtsisadrug-freeinstitution.Anyactivities involving using, selling, manufacturing, or displaying illegal drugs are strictly prohibited on campus grounds and will result in employment or academic program termination. Anyone suspected of being under the influence of a controlled substance while on school property will be subjected to a drug test. DrugandAlcoholPrevention Gurnick Academy of Medical Arts is committed to protecting all employees’ and students’ safety, health, and well-being. We recognize that drug use and alcohol abuse pose significant threats to our goals. We have established a drug-free workplace program that balances our respect for individuals with the need to maintain adrugandalcohol-freeenvironment. Gurnick Academy of Medical Arts encourages employees and students to seek help with drug and alcohol problems voluntarily. The Owner of Gurnick Academy of Medical Arts must certify to the U.S. Department of Education that a Drug and Alcohol Prevention Program and Drug-Free Policy are in place and maintained. This policy includes and is not limited to all students, employees, and anyone conducting business on behalf of Gurnick AcademyofMedicalArts. Applicability This policy applies to anyone representing or conducting business with or for Gurnick Academy of Medical Arts. Therefore, this policy applies during all work and school hours, whenever engaging in business with or representing Gurnick Academy of Medical Arts, on-call or paid standby, on academy property, or at academy-sponsoredevents/sites. Prohibited Behavior It is a policy violation to use, possess, sell, trade, or offer alcohol, illegal drugs, or intoxicants on campus or at a Gurnick Academy of Medical Arts-sponsored site/activity. Being intoxicated while on campus or conducting academybusinessisaviolation. Being under the influence of any substance, such as marijuana, is prohibited while attending Gurnick Academy of Medical Arts or any off-site activity associated with the institution, such as clinical experiences and field trips. The Gurnick Academy of Medical Arts’ drug-free policy must follow federal laws, regardless of State of law, as an institution with approval to distribute Title IV funds to those who qualify. For example, federal laws classify marijuana as an illegal drug, regardless of whether you may have a medical marijuana card or the substance is legal within California. Notification of Convictions Any employee or student convicted of a criminal drug or alcohol violation must notify Gurnick Academy of 125

Medical Arts in writing within five (5) calendar days of the conviction. Gurnick Academy of Medical Arts will act appropriately within thirty (30) days of notification. Consequences One of the goals of our drug and alcohol-free workplace program is to encourage employees/students to seek help with alcohol and drug problems voluntarily. If an employee or student violates the policy, sanctions may include 1. Mandatedtreatmentfortheissue. 2. Mandatedtreatmentatalocaltreatmentcenter. 3. Mandatedcompletionofadrugrehabilitationprogram. 4. Mandatedprobationperiodshouldnotexceedone(1)month. 5. Termination from the school or discharge from employment. Gurnick Academy of Medical Arts will terminate a student or employee after receiving notification that the individual has been convicted of a drug crime. Gurnick Academy of Medical Arts will also require that the employee or student participate in a drug abuse assistance or rehabilitation program approved by a Federal, State, or local health enforcement agency or other appropriate agency. Eligibility for Title IV programs may be suspended or terminated as part of a conviction. Assistance Gurnick Academy of Medical Arts recognizes that drug and alcohol abuse and addiction are treatable illnesses. We also realize that early intervention and support improve the success of rehabilitation. To support our employees/students, our drug-free workplace policy: 1. Encourages employees and students to utilize the services of qualified professionals in the community to assess the seriousness of suspected drug or alcohol problems and identify appropriate sources of help. 2. Ensures the availability of a current list of qualified community professionals. Theultimatefinancial responsibility for recommended treatment belongs to the employee and student. Resources TheCenterforSubstanceAbuseTreatmentandReferralHotline:1.800.843.4971 TheNationalClearinghouseforAlcoholandDrugInformation:1.800.729.6686 SubstanceAbuseTreatmentFacilityLocatorbyCity:findtreatment.samhsa.gov/locator. Table 20. Resources Location Resource ContactInformation CountyofSantaClaraBehavioral (800) 704-0900, option 2. SanJose,CA Health Services TheCampRecoveryCenter 3192GlenCanyonRd,ScottsValley,CA95066 SanJose,CA (877) 430-7785 JohnMuirBehavioral 2740GrantStreet,Concord,CA94520, Concord,CA Health Center for Recovery (925) 674 -4100 RecoveryManagementServices 2449PachecoStreet,Concord,CA94520, Concord,CA Crossroads Treatment Center Inc. (925) 682-5704 Nirvana Drug and Alcohol Institute 1100Kansas,SuiteB,Modesto,CA9535, Modesto,CA Outpatient (209) 579-1151 126

416CorsonAvenue,Modesto,CA95350, Modesto,CA Living Center (877) 399-0049 MentalHealthSystemsInc.Fresno 2550WestClintonAvenue,Fresno,CA93705, Fresno, CA CenterforChange (559) 264-7521 611EastBelmontAvenue,Fresno,CA93701, Fresno, CA WestCareCalifornia Inc. (559) 237-3420 SacramentoCountyProbation 3201FlorinPerkinsRoad,Sacramento,CA95826 Sacramento,CA Adult Drug Court Treatment Center (916) 875-1171 3600PowerInnRoad,SuiteC,Sacramento,CA Bridges Inc Sacramento,CA 95826 Outpatient Services (916) 450-0700 rd Los Angeles Centers for Alcohol and 470East3 Street,A&B,LosAngeles,CA90013 VanNuys,CA DrugAbuse (213) 626-6411 Confidentiality All information received by Gurnick Academy of Medical Arts through the drug-free workplace program is confidential. Access to this information is limited to those who must know to comply with relevant laws and managementpolicies. SharedResponsibility A safe, productive, drug-free workplace is achieved through cooperation and shared responsibility. Students and employees, including management, have essential roles to play. All employees and students are required not to report to work or school while their ability to perform duties is impaired due to on- or off-duty use of alcohol or other drugs. In addition, employees and students are to report dangerous behavior to their appropriate designated official and inform their supervisor or program coordinator of any over-the-counter or prescription medications that may affect their performance/behavior. The supervisor and instructor are responsible for the following: 1. Observeemployeeandstudentperformance. 2. Investigate reports of dangerous practices. 3. Documentnegativechangesandproblemsinperformance. 4. Counselemployeesandstudentsastoexpectedperformanceimprovement. 5. Clearly state the consequences of policy violations. ReasonableSuspicionTesting Testing may be required where there is reasonable suspicion based on objective symptoms. This includes factors related to appearance, behavior, or speech if the employee or student is found to have physical evidence (i.e., drug or alcohol paraphernalia). Following an injury or other incident causing suspicion of drug or alcohol use, Gurnick Academy of Medical Arts management may elect to test. Communication Communicating our Drug-Free Policy to employees and students is critical to our success. To ensure that all employeesandstudentsknowtheirroleinsupportingourprogram: ● Allemployeesandstudentswillreceiveawrittencopyofthepolicyandprogram. ● Thepolicyandprogramwillbereviewedwithnewemployeesandstudentsinorientationsessions. ● Allemployeesandstudentswillreceiveanupdatedpolicyandprogramannually. ReviewofthisPolicy Gurnick Academy of Medical Arts will review the Drug-Free Policy/Drug and Alcohol Prevention Program at 127

least once every two (2) years. Alcoholic Beverage Programs The possession, sale, or furnishing of alcohol on the Gurnick Academy of Medical Arts campus is governed by the Campus Director/Administrator and California state law. Laws regarding the possession, sale, consumption, or furnishing of alcohol are controlled by the California Department of Alcohol and Beverage Control (ABC). However, the enforcement of alcohol laws on campus is the primary responsibility of the Campus Director/Administrator. The campus has been designated Drug-free. The possession, sale, manufacture, or distribution of any controlled substance is illegal under state and federal laws. Such laws are strictly enforced. Violators are subject to disciplinary action, criminal prosecution, fines, and imprisonment. It is unlawful to sell, furnish, or provide alcohol to anyone under 21. The possession of alcohol by anyone less than 21 years of age in a public place or a place open to the public is illegal. It is also a violation of the Alcohol Policy for anyone to consume or possess alcohol in any public or private campus area without prior approval from the Campus Director/Administrator. Students, employees, or groups violating alcohol/substance policies or laws may be subject to sanctions by Gurnick Academy of Medical Arts. Illegal Drugs The campus has been designated “Drug-free.” The possession, sale, manufacture, or distribution of any controlled substance is illegal under state and federal laws. The Campus Director strictly enforces such laws. Violators are subject to disciplinary action, criminal prosecution, fines, and imprisonment. PreventionPrograms Gurnick AcademyofMedicalArtshasdevelopedaprogramtopreventstudents’andemployees’illicitdrugand alcohol abuse. The program provides drug use and abuse services, including disseminating referrals and disciplinary actions. The Campus Director will provide referral services upon request. Local, State, and Federal Legal Sanctions LawsGoverningAlcohol,ControlledSubstances&HealthRisks A violation of any law regarding alcohol and controlled substances is also a violation of the Student CodeofConduct.Itwillbetreatedasaseparatedisciplinarymatter. California sets 21 as the minimum age to purchase or possess any alcoholic beverage. The unlawful use, possession, distribution, manufacturing, or dispensing of illegal drugs is prohibited. Substance abuse may result in serious health problems or even sudden death, which can occur after first-time useinthecaseofsomedrugs(e.g.,cocaine).Thefollowingisapartiallistofotherpotentialhealthrisks: Acute difficulties; Heart attack; Stroke; Long-lasting effects; Disruption of normal heart rhythm; High blood pressure; Destruction of brain cells; Permanent memory loss; Infertility and impotence; Immunesystem;impairment;Kidneyfailure;Cirrhosisoftheliver;Pulmonarydamage,etc. Specific ordinances regarding violations of alcohol laws, including driving while intoxicated as well as for the unlawful possession or distribution of illegal drugs and alcohol, include the following: ● No person may sell, furnish, give, or cause to be sold, furnished, or given away any alcoholic beverage to a person under 21. No person under the age of 21 may purchase alcoholic beverages. (California Business and Professions Code 256560). 128

● It is unlawful for anyone under 21 to possess alcoholic beverages on any street, highway, or place opentopublicview.(California Business and Professions Code 25662). ● It is a misdemeanor to sell, furnish, or give away an alcoholic beverage to any person under the age of 21 (California Business and Professions Code 25658) or anyone visibly intoxicated (California Business Professions Code 25602). ● It is unlawful for any person to drink while driving or have an open container of an alcoholic beverage in a moving vehicle. With a blood alcohol level of .08 or higher, a driver is presumed to be under the influence of alcohol. Between .05% and .08%, a person may be found guilty of driving undertheinfluence(VehicleCode23153). ● Every person found in public under the influence of intoxicating liquor, any drug, controlled substance, or any combination of the above and cannot exercise care for their or the safety of others is guilty of a misdemeanor (Penal Code 647(f). ● It is unlawful to possess controlled substances: Imprisonment in State prison for possessing specified controlled substances, including opium derivatives and cocaine (Health and Safety Code Section 11350). ● It is unlawful to sell controlled substances: Imprisonment in State prison for two to four years for possession or sale of specified controlled substances, including opium derivatives and cocaine (Health and Safety Code Section 11351). ● Itisunlawfultopossessmarijuanaunderthefollowing: o Possession ofnotmorethan28.5gramsormorethanfourgramsofconcentratedcannabis or both shall be punished as follows: ▪ Upon a first offense, individuals under 18 years of age must complete four (4) hoursofdrugeducationorcounselingandupto10hoursofcommunityservice. ▪ Individuals at least 18 years of age but less than 21 years of age shall be guilty of an infraction and punishable by a fine of not more than $100 (Health and Safety CodeSection11357(b)) o Possession of more than 28.5 grams of marijuana or more than four (4) grams of concentrated cannabis shall be punished by imprisonment in county jail and a fine of not morethan$500. ● It is unlawful to possess with intent to sell marijuana: shall be punished by imprisonment in the State prison (Health and Safety Code Section 11359). ● It is unlawful to distribute prescription drugs: it is unlawful for any person who is not a pharmacist to manufacture, compound, furnish, sell, or dispense any dangerous drug or dangerous device or to dispense or compoundanyprescription(BusinessandProfessionsCodeSection4051(a)). ● It is unlawful to be under the influence of a controlled substance: No person shall use or be under any controlled substance. Any person convicted of violating this is guilty of a misdemeanor and shall be sentenced to serve under 90 days or more than one (1) year in county jail. (Health and Safety CodeSection11550(a)). References Health and Safety Codes leginfo.legislature.ca.gov/faces/codesTOCSelected.xhtml?tocCode=HSC&tocTitle=+Health+and+Safety+Code+- +HSC Penal Codes leginfo.legislature.ca.gov/faces/codesTOCSelected.xhtml?tocCode=PEN&tocTitle=+Penal+Code+-+PEN Vehicle Code leginfo.legislature.ca.gov/faces/codesTOCSelected.xhtml?tocCode=VEH&tocTitle=+Vehicle+Code+-+VEH Drug use during pregnancy may result in fetal damage and congenital disabilities, causing hyperactivity, 129

neurological abnormalities, and developmental difficulties. PREGNANCY Gurnick Academy of Medical Arts provides students with a safe environment for clinical experiences and training. In compliance with regulations regarding pregnant students, female students have the option to inform program officials whether they are pregnant. With written notification to the Program Director, the student may change from one option to another during the pregnancy if all program objectives, courses, and competenciesarecompleted. However, if a student chooses to declare her pregnancy to program officials, she must provide written notification. Pregnant students may seek counseling from a radiation safety officer (RSO) or other qualified individuals. Upon student disclosure, the student will be provided a fetal dose monitor and instructions for use. Associate of Science in Radiologic Technology and Associate of Occupational Science in Radiologic Technology Program students: Upon declaration of pregnancy, Gurnick Academy of Medical Arts will ensure compliance with the lower radiation exposure limit and dose monitoring requirements outlined in the Radiation Protection Policy. A student may submit a written request to withdraw her declaration unquestionably at any time. A student whohas decided to declare her pregnancy will be allowed to choose one option for completing their Gurnick AcademyofMedicalArtstraining. Options 1. Continuing the training without modification or interruption. This option means that the student agrees to attend and complete all classes, clinical assignments, and competencies in a manner consistent with her peers within the guidelines set forth by the instructors and Gurnick Academy of Medical Arts. The student must present a letter from a physician releasing the student to continue the training. Gurnick Academy of Medical Arts reserves the right to contact the physician to verify thestudent’s physical activity level and ability to complete all clinical experience requirements. 2. The student maytakealeaveofabsenceforsuchalongperiodasisdeemedmedicallynecessaryby the student’s physician, at the end of which the student shall be reinstated to the status she held when the leave began. The student must make up all missed clinical and didactic hours and completeallthenecessarycompetencies.Thisoptiontimingiscontingentuponanavailablestudent position in an appropriate clinical facility. Associate of Science in Nuclear Medicine Technology students: Upon declaration of pregnancy, Gurnick Academy of Medical Arts will ensure compliance with the lower radiation exposure limit and dose monitoring requirements outlined in the Radiation Protection Policy. The student will then be counseled and review the U.S. Nuclear Regulatory Commission Appendix to Regulatory Guide 8.13, “Possible Health Risks to Children of WomenWhoAreExposedtoRadiationDuringPregnancy.” A student may submit a written request to withdraw her declaration unquestionably at any time. A student who has chosen to declare her pregnancy will be allowed to choose one of the following options for completingtheGurnickAcademyofMedicalArtstraining. Options 1. Continuing the training with approval of the clinical site per the institution’s radiation protection policy. As a result, the student elects to continue doing so at their risk. Neither the college nor the 130

clinical affiliate can guarantee that the student would not exceed the occupational limits of 0.5 rem during the entire gestational period. This option means that the student agrees to attend and complete all classes, clinical assignments, and competencies in a manner consistent with her peers within the guidelines set forth by the instructors and Gurnick Academy of Medical Arts. The student must present a letter from a physician releasing the student to continue training. Gurnick Academy of Medical Arts reserves the right to contact the physician to verify the student’s physical activity level and ability to complete all clinical experience requirements. 2. The student maytakealeaveofabsenceforsuchalongperiodasisdeemedmedicallynecessaryby the student’s physician, at the end of which the student shall be reinstated to the status she held when the leave began. The student must make up all missed clinical and didactic hours and completeallthenecessarycompetencies.Thisoptiontimingiscontingentuponanavailablestudent position in an appropriate clinical facility. Bachelor of Science in Radiation Therapy students: If a student chooses to declare her pregnancy to program officials, she must provide written notification to the Program Director that provides a name, date, estimated date of conception, and delivery. The student must sign the letter. Pregnant students may seek counseling from a radiation safety officer (RSO) or other qualified individuals. The academy will provide the student with a fetal dosemonitorandinstructionsforuseuponthestudent’sdeclarationofpregnancy. Upon declaration of pregnancy, the declared pregnant student will be given a secondary radiation monitoring device to be worn at waist level under any protective apparel. A student may submit a written request to withdraw her declaration unquestionably at any time. A student who has decided to declare her pregnancy will be allowed to pick one option for completing their Gurnick AcademyofMedicalArtstraining. Options 1. Waive liability and decide not to withdraw voluntarily from the program and complete the program with no modification (if voluntarily declaring pregnancy). This option means that the student agrees to attend and complete all classes, clinical assignments, and competencies in a manner consistent with their peers within the guidelines set forth by the instructors and Gurnick Academy of Medical Arts. The student must present a letter from a physician releasing the student to continue the training. Gurnick Academy of Medical Arts reserves the right to contact the physician to verify the student’s physical activity level and ability to complete all clinical experience requirements. 2. Temporarily withdraw from the program if and when the pregnancy interferes with your education (if voluntarily declaring pregnancy). The student may exit the program and join the next cohort. If the student selects this option, the student will need to follow the program reinstatement policy. Because the didactic and clinical externships are offered in a lock-step fashion, it is impermissible for astudenttocontinueclassesandcompletetheexternshipoutofsequence. 3. Withdrawdeclarationofpregnancy(ifyoupreviouslyvoluntarilydeclaredyourpregnancy). If a declared pregnant student receives a dose of 0.05 rem (0.5 mSv) in any month of pregnancy or greater than 0.5 rem (5 mSv) at any time during the pregnancy, the student will be removed from the externship until after delivery. For students in the Dental Assistant, Associate of Occupational Science in Cardiac Ultrasound Technology, Associate of Occupational Science in Ultrasound Technology, Associate of Occupational Science in Vascular Ultrasound Technology, Associate of Science in Respiratory Care, and Associate of Science in Magnetic 131

ResonanceImagingPrograms,thereisanadditionaloption: 1. Students may also continue the training by modifying clinical assignments. This option means the student would choose to delay clinical assignments and competencies in areas high in potential hazardous exposure. However, to accomplish this, the training may need to be extended. The student must make up all missed clinical and didactic hours and complete all the necessary competencies. The student will present a letter from a physician releasing the student to continue training. There is an additional option for students in the Dental Assistant, Associate of Science in Radiologic Technology, andAssociateofOccupationalSciencein Radiologic Technology: Students have the right to undeclare their pregnancies. Modifications will be determined on an individual basis per programmatic completion requirements. STUDENTBEREAVEMENT Recognizing that grief is challenging, every effort will ensure that a bereaved student can attend to family matters. The student will provide documentation of the death or funeral service to the Program Coordinator. A designated School Official will inform the student’s instructors of the student’s leave. ImmediateFamily Students are eligible for up to three (3) days of excused absence over five (5) consecutive calendar days for the death of a spouse, domestic partner, parent, child, grandparent, grandchild or sibling, or a corresponding in-law or step-relative. Relative Living in the Student’s Home Students are eligible for up to three (3) days of excused absence over five (5) consecutive calendar days for the deathofanuncle,aunt,niece,nephew,orfirstcousinlivinginthestudent’shome. Relative Students are eligible for one (1) day of excused absence for the death of an uncle, aunt, niece, nephew, or first cousin. If the death of another family member or friend is not explicitly included within this policy, a bereaved student should petition for grief absence through the Program Coordinator. Travel and Absences Additional days may be granted depending on the miles needed. No additional excused absence days are allowed within a 150-mile (241.4 km) radius of the student campus. One extra excused absence day may be permitted between 150 miles (241.4 km) and 300 miles (482.8 km) of the student campus. Two additional excused absence days may be taken beyond a 300-mile radius of the student campus. Outside the 48 contiguous United States, four further excused absence days may be approved. MakingupClockHours Hours cannotbeguaranteed,possiblyaffectingthestudent’sgraduationdateandcompletionstatusdepending on where the student is in the program and the nature of the Gurnick Academy of Medical Arts educational structure. The student must make up all hours missed and complete all the necessary competencies. Given proper documentation, didactic instructors will excuse the student from class, provide the opportunity to earn equivalent credit, and demonstrate evidence of meeting the learning outcomes for missed assignments or assessments. Making up Clinical Hours is also contingent upon an available student position in appropriate clinical facilities. 132

CHANGEOFNAME Anychangestoastudent’scurrentorformerlegalnamerequirethefollowing: ● Oneofthefollowing: ○ acertifiedcopyoftheirbirthcertificate ○ valid(current)passport ○ amarriagelicenseissuedbyacountyorcityclerk ○ adivorcedecreefromacourtoflaw ○ acourt-orderednamechange ● The second piece of identification (with the new name) must be a government-issued photo ID. Changes of Name Forms are available on www.gurnick.edu/student-forms/ or by asking a campus designee. Students must complete the Change of Name Form and bring the above-mentioned official documents in person to the Student Services Coordinator or Designated School Official located on their campus or mail notarized copies of documents with a cover letter explaining the change. If they mail the certified documents, Students must sign the cover letter and include their Gurnick Academy of Medical Arts student ID or social security number and date of birth. Mail shouldbesenttothestudent’scampus. The Student Services Coordinator or Designated School Official will photocopy the official documents evidencing the name change and file these documents in the appropriate student folder with the completed ChangeofNameForm. STUDENTDRESSCODE The Student Dress Code applies whenever the student is at the campus or a clinical site in a clinical or didactic setting. Students must maintain a neat, clean, and professional appearance while attending Gurnick Academy of Medical Arts. This helps to ensure a positive teaching and learning environment for all students and is essential to the image and safe operation of Gurnick Academy of Medical Arts. Dress codes in the medical profession are common, and our dress code is designed to teach our students to adhere to policies and look professional. Our dress code identifies the student as a medical professional in training. GeneralRequirements All students attending class on campus must wear school-designated scrubs and white professional medical shoes (non-porous material, leather or pleather, that can be easily cleaned and polished) during the didactic, laboratory, and clinical sites. The uniform consists of blue scrub tops and bottoms and a sweater. Students may wear white short-sleeved or long-sleeved undershirts without visible designs for additional warmth. Individual programsmayenforceastricterdresscode. While attending a clinical site, students must adhere to the Gurnick Academy of Medical Arts and Designated Clinical Facility Policies. Violating the dress code policy may result in disciplinary action, including being sent home. Clinical sites requesting an exception to the Gurnick Academy of Medical Arts Dress Code Policy will needtoprovidetheirrequestinwriting,andaccommodationswillonlybemadeforthatclinicalsite. Exceptions or Additions to the Student Dress Code by Program Physical Therapist Assistant (A.S. in PTA) and Ultrasound Technology (A.O.S. in UT) Programs Students must wear Khaki pants and Gurnick Academy of Medical Arts-supplied shirts for didactic sessions. 133

Physical Therapist Assistants and Ultrasound students must wear the Gurnick Academy of Medical Arts supplied shorts and shirts for the lab. Women must wear a tank top or sports bra if shirts are removed. Distance Education (Online) Programs Students enrolled in Distance Education (Online) programs, including B.S. in DMI, are not required to abide bytheabovedresscode. BachelorofScienceinNursing(BSN)Program Students in the BSN program are exempt from the above dress code for the externship portion of the program.However,studentsmustdressappropriatelyforthefacilitytheyattendfortheirexternshiphours. PERSONALAPPEARANCEANDHYGIENE In addition to the above dress code, students must always maintain a neat and professional appearance and personal hygiene. The guidelines below are for the student’s health, safety, professionalism, and the patient’s comfort in being cared for by a medical professional in training. Kindly note that the following requirements are not all-encompassing. Circumstances that are not covered by this policy may include: ● Studentswithlonghairmustalwayskeepitupandawayfromtheirfaces. ● Students must wear their Gurnick Academy of Medical Arts Identification Badge at shoulder or chest height. (Clinical facilities may additionally require an identification badge issued by their departmenttobewornduringthestudents’clinicalexperiencesattheirfacility). ● Tattoos must be covered. Tattoos on the arms (including the upper arm, forearm, and wrists) must be covered by long sleeves. A white undershirt or turtleneck must cover tattoos on the chest and extend up the neck without visible designs. Tattoos that cannot be covered must not convey a messagecontrarytoprofessionalstandardsandmustnotposeapotentialcustomerrelationsissue. ● Undergarmentsmustbewornatalltimes. ● Fragrancesmustbeavoided. ● Jewelry must be discrete and provide no risk to the wearer or patient. Visible piercing jewelry is not allowed. ● Noheadcoverings,includinghats,exceptforverifiedreligiouspractices. ● Neatlytrimmed,naturallycoloredfingernails;nolongartificial nails are permitted. ● Facialhairmustbecloselytrimmed. ● Anymakeupmustbeminimal. ● Dailyhygieneadheredto(shower,deodorant,oralcare). ● This list is not meant to be exhaustive; other requirements may be applied as deemed professional byGurnickAcademyofMedicalArts. CELLPHONE Cell phones must always be turned off in class* and clinical settings. Students may use their cell phones on campus before or after class and during breaks in the posted designated areas or outside Gurnick Academy of Medical Arts. Students who do not comply with this policy are subject to disciplinary probation or expulsion at thediscretion of the Gurnick Academy of Medical Arts administration. *Please note that some instructors may allow restricted cellphone use in class for certain activities. ADMINISTRATIONOFEXAMINATION 134

All electronic devices must be turned off while administering all evaluation forms and displayed within the instructors’ view. All non-electronic personal belongings will be stored out of all class members’ view by storing belongings under the chair or desk. There will be no talking or questions during the administration of evaluations. Forms of evaluation include but are not limited to quizzes, tests, and examinations. Students who do not comply with this policy are subject to disciplinary probation or expulsion at the discretion of Gurnick AcademyofMedicalArtsadministration. ELECTRONICRECORDING Gurnick Academy ofMedicalArtsprohibitsvideorecordingonacademygroundsorataclinicalsitebystudents or any other individuals who have not secured written permission from the administration of Gurnick Academy of Medical Arts. This policy protects the privacy of all students, faculty, staff, clinical site employees, and patients and protects the confidentiality and intellectual property of all instructional material and curricula. Voice recording is solely permitted during a lecture class with the instructor’s permission and when used for the educational purpose of an individual’s studying resource. Any student violating this policy will be immediately expelled from Gurnick Academy of Medical Arts and will not be permitted to re-enroll per the Gurnick AcademyofMedicalArts’Re-enrollmentPolicy’sguidelinesonexpulsionduetodisciplinaryaction. VIDEOANDAUDIOSURVEILLANCENOTIFICATION When on Gurnick Academy of Medical Arts premises, individuals enter an area where video and audio recording may occur. By entering the premises, individuals consent to video and audio recording and release Gurnick Academy of Medical Arts, its officers, employees, and each and all persons involved from any liability connectedwiththevideoandaudiorecordings. To promote the safety of employees and students and the security of its facilities, Gurnick Academy of Medical Arts may conduct video and audio surveillance of any portion of its premises at any time. These video cameras will be positioned appropriately within and around Gurnick Academy of Medical Arts. The only exception to surveillance is within private areas such as restrooms. By entering the premises, individuals waive any right to inspect or approve any video or audio recordings taken byGurnickAcademyofMedicalArtsorthepersonorentitydesignatedtoviewrecordings. TRANSFER WithintheProgram Students maybeconsideredfortransferfromonecohortintoanotherwithinthesameprogramif: ● StudentsarereturningfromLOAbytheexpectedreturndate ● StudentsarecurrentlyActive(studentshavestartedtheprogram)andwishto: o TransferfromAM/PMorPM/AM o Transfertoanothercampus Students may not be eligible for transfer if there is a large discrepancy in cost, length, start date, and availability of programs and seats in the preferred group or campus. ToAnotherProgram Students not eligible for transfer within the program may withdraw from the current program and enroll in the 135

desired program. Please see the Re-Enrollment Policy for further details. Transfer students are not subject to paying a $100.00 Registration Fee. TRANSFERABILITYOFCREDITSANDCREDENTIALS The transferability of credits you earn at Gurnick Academy of Medical Arts is at the discretion of the institution to which you may seek to transfer. Acceptance of the (degree, diploma, or certificate) you earn in the educational program is also at the complete discretion of the institution to which you may seek to transfer. If the (credits, degree, diploma, or certificate) you earn at this institution are not accepted by the institution you seek to transfer to, you may be required to repeat some or all of your coursework there. Thus, you should confirm that attendance at this institution will meet your educational goals. This may include contacting an institution you may seek to transfer to after attending Gurnick Academy of Medical Arts to determine if your (credits or degree, diploma, or certificate) will transfer. UNITOFCREDIT Academic credit is measured in quarter credit, semester credit, or clock hours. Typically, one hour of instructional time is defined as fifty minutes. Credits solely earned at Gurnick Academy of Medical Arts determine progress toward program completion. Credits are not usually transferable to another school, college, or university. Quartercredit hours are determined as follows: 10hoursoflectures=1quartercredithour 20hoursoflaboratory=1quartercredithour 30hoursofclinical = 1 quarter credit hour Semestercredithoursaredeterminedasfollows: 15hoursoflectures=1semestercredithour 30hoursoflaboratory=1semestercredithour 45hoursofclinical = 1 semester credit hour ESTIMATEDTIMEFOROUTSIDE-OF-SCHOOLPREPARATIONHOURS(OSPH) The OSPH policy estimates the number of hours it takes students to perform outside-of-school preparation activities. Such activities that will require students to study outside regularly scheduled hours in school include butarenotlimitedto ● Homeworkassignments ● Testandquizpreparations ● Reportscompetitions ● Otherassignments ThenumberofhoursittakesstudentstoperformOSPHisestimatedusingthefollowingmethodology: “The average adult reading rate is 250 words per minute with 70% comprehension. [Smith, Brenda D. “Breaking Through: College Reading” 7th Ed. Longman, 2004]. Reading for learning (100-200 wpm), reading for comprehension (200-400 wpm), and skimming (400-700 wpm). With an average of 400 words per page, at 200 words per minute, a student should read around 30 pages per hour (200 words per minute x 60 = 12,000 words per hour divided by 400 = 30 pages per hour). Therefore, we are using 25–30 pagesperhour.Audiobooksarerecommendedtobe150–160wordsperminuteor22pagesper 136

hour. Reading on Monitor: 180-200 wpm or 27 pages per hour. Slide presentations are closer to 100 wpmor15pagesperhour.” OSPH-related activities may be graded. Quarter Credit programs: Students must spend at least five (5) hours of OSPH per quarter credit (didactic or lab) to receive credit. Semester Credit program: Students must spend at least 7.5 hours of OSPH per semester credit (didactic or lab) to receive credit. STUDENTGRIEVANCEANDAPPEALS Gurnick AcademyofMedicalArtsisdedicatedtofairtreatmentandprofessionalconductwithstudents.In compliancewiththeOfficeofCivilRights(OCR)recommendations,thispolicyandprocedureaboutgrievances of various natures, including but not limited to academic, discrimination, harassment, and bullying. Students are first encouraged to discuss any concerns or questions regarding policies or decisions rendered directly with the party with whom the student has a concern. Should any student have a complaint, the student is asked to discuss the matter within five days directly with an Instructor or Administrative Manager/DesignatedSchoolOfficialwhowillinitiateaninformalprocesstosincerelysettlethedispute.That informal process will involve three steps: 1.Anefforttodefinetheproblem. 2.Anefforttoidentify acceptable options for resolution. 3.Anattempttoresolvetheconflictbyapplyingoneormoreacceptableoptionsforresolution. Shouldthestudentfeeltheissuehasnotbeensatisfactorilyresolved,theymay,withinfive(5)days,filea written complaint directly with the Program Director. The Program Director will do their best to resolve the matterforthestudentandGurnickAcademyofMedicalArts. TheProgramDirectorwilltrytoresolveoralleviatethecomplaintorgrievancethatthestudentpresents within five (5) days of receipt. If, after following these steps, the Program Director cannot remedy the issue and thestudentisstill unsatisfied with the solution. The Campus Director will investigate all written complaints, attempttoresolveallsuchcomplaintsandrecordanentryintothecampus’sofficiallog. Theformalprocesswillrequirethestudent’ssubmissionofawrittendescriptionofthespecificcomplaintand thedesiredremedy,accompaniedbyanyavailabledocumentation.TheCampusDirectorwillhavefive(5)days to respond to the grievance and determine proper action. The Campus Director may notify the student of the decision reached. Students may also follow the Appeals Procedures outlined below for further action if necessary. Toprovidestudentswithaneutralmechanismforthereconsiderationofdisciplinaryactionsorperformance evaluations that would necessitate the dismissal of the student from a program, Gurnick Academy of Medical Arts has a designated Appeals Committee consisting of the following individuals: Chief Academic Officer, Chief Operations Officer, Chief Executive Officer, and Vice President, Campus Operations. Note: A student must stay within the appeal process and not contact the Appeal Committee members for any reason unless directed to dosobyaCampusDirectororCommitteemember.Astudentwhogoesoutsidetheprocedureofthispolicy will be denied their appeal. ShouldtheCampusDirectorbeunabletoremedytheissueandthestudentisstillunsatisfiedwiththe outcome,thestudentmayasktheCampusDirector,inwriting,toforwardallwrittengrievancesand correspondencetotheAppealsCommittee.TheAppealsCommitteewillhavefive(5)workingdaystorespond to the appeal and determine proper action. 137

All grievances and appeals will be handled discreetly. Dissemination of the resolution will be at the discretion of the CampusDirector or Appeals Committee and on a “need-to-know” basis. The decisions rendered by the AppealsCommitteewillbethefinalandbindingdecisionofGurnickAcademyofMedicalArts. At any time, a student or any member of the public may file a complaint about Gurnick Academy of Medical Arts with the Bureau for Private Postsecondary Education by calling 888.370.7589 toll-free or completing a complaint form obtainable on the bureau’s Internet website at www.bppe.ca.gov. Associate of Science in Physical Therapist Assistant (A.S. in PTA) at Gurnick Academy of Medical Arts is accredited by the Commission on Accreditation in Physical Therapy Education (CAPTE), 3030 Potomac Ave., Suite 100, Alexandria, Virginia 22305-3085; telephone: 703-706-3245; email: [email protected]; website: http://www.capteonline.org. If you need to contact the program/institution directly, please call 650- 425-9672 or email [email protected]. All VN students may contact the Board of Vocational Nursing and Psychiatric Technicians regarding the education program. The BVNPTcontactinfoisBVNPT2535CapitalOaksDrive,Suite205Sacramento,CA 95833-2945Phone:916-263-7800Fax:916-263-7859Web:www.bvnpt.ca.gov. Students in a Joint Review Committee on Education in Radiologic Technology (JRCERT) accredited program havetherighttocontacttheJRCERTregardingconcernsabouttheireducationprogram.TheJRCERTcontact information is 20 North Wacker Drive, Suite 2850, Chicago, IL 60606-3182. Phone: (312) 704-5300. E-mail is [email protected]. The website is www.jrcert.org. Students maybewithdrawneitherbyself-withdrawalorbyacademicwithdrawal.Astudentwho self-withdraws will be processed through the drop process. Students who are academically withdrawn can dispute the withdrawal through the student grievance and appeals process. To initiate the grievance and appeals process, the students must submit a written appeal within five (5) days of being notified of the withdrawal. After five (5) days, the student will be dropped via the drop process if no written appeal has been submitted. Thestudentgrievanceandappealsprocesswillstartifawrittenappealissubmittedwithintheallottedtime. ThestudentwillbeplacedonActiveWarningstatusandmustattendallinstructionuntilthegrievanceand appeals process has been completed and a final decision has been made. Please see the Student Grievance andAppealssectionfordetailedinformation. COPYRIGHT It is the policy of Gurnick Academy of Medical Arts to respect the copyright protections given by federal law to owners of texts, publications, documents, works of art, digital materials, and software and to abide by all license and contractual agreements in the provision of resources and services to Gurnick Academy of Medical Arts. Gurnick Academy of Medical Arts community members are advised to become as knowledgeable as possible regarding copyright law and this policy. Individuals who willfully disregard this policy and guidelines do so at their own risk and may be subject to personal liability. Gurnick Academy of Medical Arts regards a violation of this policy as a serious matter. Any such violation is without its consent and is subject to disciplinary action, including termination of Gurnick Academy of Medical Arts employees and expulsion of students. The use of copyrighted material(s) is permissible with written permission from the owner(s). The Campus Director can provide a sample request letter. When consent is received, please provide a copy of the signed 138

letter to the Campus Director. The Campus Director will review the letter’s content and either give or deny the request to utilize the texts, publications, documents, works of art, digital materials, or software requested. Gurnick Academy of Medical Arts prohibits using its equipment to access, use, copy, reproduce, or make available to others, including unauthorized peer-to-peer sharing, any copyright-protected materials or software except as permitted under copyright law or specific license. Specifically, users are prohibited from ● Copying or reproducing any texts, publications, documents, works of art, digital materials, and software on Gurnick Academy of Medical Arts’ photocopiers, fax machines, or computing equipment, except as expressly permitted in writing by the owner. Furthermore, users may not use unauthorized copies of texts, publications, documents, works of art, digital materials, and software on-site at Gurnick Academy of Medical Arts facilities, owned computers, or personal computers housedintheinstitution’s facilities. ● Copying, downloading, or uploading audio recordings, music, movies, videos, and other copyright-protected files electronically without the owner’s written permission. ● Posting copyrighted material on a Gurnick Academy of Medical Arts-owned website (official or personal). Additionally, faculty, staff, administrators, and students must: ● Fullyread,understand,andabidebyalltermsofsoftwarelicenseagreements. ● Whereapplicable, removeanycopyrightedmaterialfromGurnickAcademyofMedicalArtsfacilities or downloaditfromthewebaftertheexpirationoftheevaluationperiod. ● Notacceptunlicensedsoftwarefromanythirdparty. ● Not install, nor direct others to install, illegal copies of computer or unlicensed software onto any institution-owned or operated computer system. Gurnick Academy of Medical Arts does not routinely monitor the network for illegal activity violating institutional policy. However, Gurnick Academy of Medical Arts reserves the right to monitor network use for operational needs and ensure compliance with applicable laws and institutional policies. Gurnick Academy of Medical Arts has a legal duty to comply with applicable laws protecting third parties’ intellectual property rights and respond to formal legal complaints it receives. Gurnick Academy of Medical Arts reserves the right to authorize removing any illegal copyright material or disconnecting a user’s account if the user represents a severe threat to system integrity or is a liability to the institution. Gurnick Academy of Medical Arts may refer suspected violations of applicable law to appropriate lawenforcementagencies. Any provision of this policy ruled invalid under the law shall be deemed modified or omitted solely to the extent necessary to comply with said law. The remainder of the policy shall continue in full force and effect. Penalties for copyright infringement include civil and criminal penalties. In general, anyone liable for civil copyright infringement may be ordered to pay either actual damages or “statutory” damages affixed at not less than $750.00 and not more than $30,000.00 per work infringed. A court may award up to $150,000.00 per work infringed. A court can also assess costs and attorneys’ fees at its discretion. See Title 17, United States Code,Sections504,505. Willful copyright infringement can also result in criminal penalties, including imprisonment of up to five (5) years and fines of up to $250,000.00 per offense. For more information, please see the U.S. Copyright Office website at www.copyright.gov, especially their FAQs 139

at www.copyright.gov/help/faq. FILE SHARING The computers at Gurnick AcademyofMedicalArtsarestrictlyforsupportingtheschool’smissionandareonly used by our students, faculty, and staff. No user should perform any action which may be deemed inappropriate or dangerous. All use of Gurnick Academy of Medical Arts’ computers should be within the ethical standards of Gurnick Academy of Medical Arts. This includes but is not limited to plagiarism, illegal file sharing, or the distribution of copyrighted material. Gurnick Academy of Medical Arts students, faculty, and staff violating this policy are subject to disciplinary probation, suspension, or termination at the discretion of Gurnick Academy of Medical Arts administration. In addition, any user violating State or Federal laws is responsible for the consequences of their actions, including civil action or criminal prosecution. PLAGIARISM Plagiarism is defined as “literary theft,” i.e., the presentation and passing off of one’s original ideas, words, or writings of another. One common violation is the use of another student’s work without acknowledgement. Themostcommonviolationinvolvesastudentusingpublishedmaterialsandfailingtoacknowledgethe sources. Copyingadirectquotationwithoutusingquotationmarksorcreditingthesourceisconsideredplagiarism. Anotherformofplagiarismconsistsofparaphrasingorusinganoriginalideawithoutproperlyintroducingor documentingtheparaphraseorborrowedidea. Theideasandwordsaretheauthor’sproperty.Theyareprotectedbylawandmustbecreditedwhen borrowed.Toavoidplagiarism,oneshould: ● Usequotationmarksforallquotedmaterials. ● Paraphrasematerial using their style and language rather than merely rearranging sentences. ● Usefootnotesorotheracceptedmethodstocredittheauthor. ● Provide a bibliography for the sources noted in the footnotes. ● Introduce the quotation or paraphrase with the author’s name of the borrowed material. Artificial intelligence (AI) content may be plagiarized from other sources. Using this content without properly citing the source will also constitute plagiarism. It is the student’s responsibility to verify all information before submitting the assignment. Submitted documents will be sent through Turnitin, a software plagiarism checker to detect original work. A Similarity report will be generated, including what percentage of the document’s content matches Turnitin’s databases. This is called the similarity score. Unless specified otherwise by the student or employee handbook, the similarity score should be no more than 25%. The Similarity Report also contains an AI score that determinestheamountofthedocumentwrittenbyanAItool. Unless the student or employee handbook specifies otherwise, the AI score should be no more than 25%. Please refer to the “Use of AI Tools” in the student catalog and student handbook for details on the permitted useofAIforeachprogram. 140

STUDENTSERVICES StudentIdentification Card Students receive badges at the beginning of their program; it is part of their Gurnick Academy of Medical Arts uniform. Initial ID badges or replacements are provided by Student Services or Front Desk. The student is responsible for all applicable fees if a replacement identification card is required. All students must always wear their Student Identification Card while in educational settings. Failure to do so could impact the student’s ability to attend instruction to complete the program’s graduation requirements or obtain certification after completion. AcademicAdvisement All applicants and students may discuss program and course selection with the applicable Program Director or AdmissionAdvisor. An appointmentis required. Accessibility for Disabled Students All campuses of Gurnick Academy of Medical Arts have accessible parking spaces available. Students with disabilities who require assistance are encouraged to disclose this information to the ADA coordinator to determineaplanofactionforsupportservices. Orientation of New Students Orientation is conducted before the beginning of each program to introduce new students to Gurnick Academy of Medical Arts. During this orientation, administration members familiarize students with Gurnick Academy of Medical Arts facilities and explain academic policies and regulations. Orientation may occur in residential or virtual modalities or combine both. Students are required to complete all orientation tasks and meetings before the start of their program. Tutor Locator Service Students who experience difficulty or have learning challenges will be assisted in locating qualified tutors, as Gurnick Academy of Medical Arts does not offer a tutoring program. Interested students should contact their Program Director. The Program Director can arrange individual tutoring to help struggling students catch up with the program and improve their academic progress. Library Resources LIRNis a 3rd party Library and Librarian Solution that Gurnick Academy partners with to provide comprehensive library resources and librarians to ensure that all faculty and staff are knowledgeable about library resources. LIRNhasnumerousonlineresourcesfromvariousvendors(includingdatabasescontainingarticlesfrom periodicals [peer reviewed, academic, and trade], eBook collections, video collections, or interactive applications. Gurnick Academyhasselectedresourcesrelevanttospecificareasofstudyatourinstitution.AllLIRNresources are intended for higher education to promote academic study, research, and growth, including all areas of GeneralEducation.GurnickAcademyissupportedbyateamofLIRNLibrarianswhohaveearnedaMaster’s degreeinLibraryScience(MLS),Librarianship, or Library and Information Studies (MLIS) from a program accredited by the American Library Association (ALA). 141

LIRN’s librarians are not faculty and/or staff of the subscriber institution. LIRN Librarians provide library support for 84 hours each week. Monday through Friday, 8:00 AM to 10:00 PM EST, and Saturday and Sunday, 12:00 PM to 7:00 PM EST. ComputerandInternetResources Loaner computers and Internet Resources are available for students at each campus. Students can access equipment and programs essential for their educational and work-related experiences. Loaner tablets may be available for check-out at the front desk. StudentInformationSystem The Student Information System is available to students for idea sharing, communication between faculty and students, quizzes and research exchange, email communications and grades, and attendance verification and review. EmploymentAssistance Gurnick Academy of Medical Arts provides job search assistance to graduates in good standing as long as the graduate continues to cooperate with the academy. Gurnick Academy of Medical Arts does not guarantee employment upon graduation. Embarking on a course of education typically enhances one’s thinking and potential productivity. The robust programs offered at Gurnick Academy of Medical Arts require significant time and effort. Due to market fluctuations, personal issues, or other factors, there is also the risk that some graduates may be unable to find employment in their training field within a time acceptable to them. Therefore, they may pursue other career options; some use their training indirectly, and some do not. Jobsearchassistancewill be provided in the form of some or all of the following: ● Interviewingskills seminars ● Resumepreparationseminars ● Jobsearchtechniquesseminars ● Referralstopotentialemployers In some allied health occupations, many jobs begin as part-time, averaging 20 to 25 hours per week, with a potential opportunity to progress to or convert to full-time employment. Finding employment is a joint effort between the student and Gurnick Academy of Medical Arts. Gurnick Academy of Medical Arts holds workshops and meetings with students and graduates. The student must agree to cooperate with our Career Services Coordinators in conducting a job search, including providing a resume, participating in scheduled workshops, attending interviews, and completing all required assignments. Further, students should understand the effort it takes to find a job upon program completion is commensurate with theprogramitself. Students must commit to a reasonable timeframe to complete the job search process, which typically takes several months beyond graduation, to maximize chances for success. During this time, the student should maintain regular weekly contact with the school. Students should also understand that a potential employer may consider a job applicant’s attitude, grades, attendance, personal performance on an interview, work background,educationalbackground,andotherintangiblefactorsinhiringtheapplicant. Gurnick Academy of Medical Arts programs are comprehensive and are designed to prepare students for entry-level positions. After obtaining an entry-level position, additional training is usually required to develop incremental skills and protocols specific to that position. An applicant for an entry-level position must adopt a 142

“get your foot in the door” approach by maintaining flexibility regarding salary, hours, location, and potential relocation to secure such employment. Housing Gurnick Academy of MedicalArtsdoesnotassumeresponsibilityforstudenthousing,doesnothavedormitory facilities under its control, nor offers student housing assistance. According to www.rentals.com, rental properties in the following cities start at approximately the following rates per month: San Jose, CA,$1,400.00; Concord, CA, $1700.00; Modesto, CA, $995.00; Fresno, CA, $685.00; Sacramento, CA, $950.00; and Van Nuys, CA,$1,295.00. StudentResources Students can obtain a list of local support services from Student Services. The list of services includes but is not limited to safety class providers, counseling services, tutoring services, medical care services, financial assistance services, and public transportation. Learning Disabilities At Gurnick Academy of Medical Arts, we understand and agree that a student’s learning disability or learning disorder/difficulty is when a student has difficulty learning using a typical approach. The causes vary; however, the causal factor is typically a disorder that affects the brain’s ability to receive and process information. In other words, learning disabilities are neurologically based conditions that get in the way of fitting attainment, management, and use of skills and knowledge. Every effort is put forth to ensure that students, faculty, and staff with disabilities at Gurnick Academy of Medical Arts receive the services and accommodations to which they are entitled. Wealso think that the learning disorder can make it problematic for a person to learn as quickly or in the same way as someone unaffected by a learning disability. People with learning disabilities have trouble performing specific skills or completing tasks if they are left to figure things out themselves or taught in conventional ways. The diagnosis of a learning disability in an adult requires documentation of at least average intellectual functioning along with deficits in such areas as ● Auditoryprocessing ● Visualprocessing ● Informationprocessingspeed ● Abstractreasoning ● Memory(long-term,short-term,visual,auditory) ● Spokenandwrittenlanguageskills ● Readingskills ● Mathematicalskills ● Visual-spatial skills ● Motorskills ● Executivefunctioning(planning) Gurnick Academy of Medical Arts believes that a learning disability is not a temporary disorder. This disability typeimpactshowstudentswithaverageorabove-averageintelligenceprocessincoming,outgoing,orboth. Learning disabilities are often inconsistent. They may be manifested in only one specific academic area, such as math or foreign language. There might be problems in grade school, none in high school, and a return during higher education. Learning disabilities are not the same as mental retardation or emotional disorders. Prevailing accommodations for students with learning disabilities are alternative print formats, taped lectures, 143

notetakers, adaptive technology, course substitutions, early syllabus, exam modifications, priority registration, andstudyskills and strategies training. Students may be required to submit documentation verifying the nature and extent of the disability receiving any accommodations. In this case, the documentation must be provided to Gurnick Academy of Medical Arts on professional letterhead and contain the diagnosing professionals’ assessment dates, signatures, titles, and license/certification numbers. Diagnoses and disabilities that do not have the required information may not be usedfordeterminingeligibility for academic accommodations. Disability Accommodation&GrievancePolicy 1. StatementofNon-DiscriminationandAccommodation a. Gurnick AcademyofMedicalArts,LCC(“theInstitute”)doesnotdiscriminatebasedondisability. b. Individuals with disabilities are entitled to a reasonable accommodation to ensure that they have full and equal access to the educational resources of the Institute, consistent with Section 504 of the Rehabilitation Act of 1973 (29 U.S.C. § 794) (“Section 504”) and the Americans with Disabilities Act (42 U.S.C. § 12182) (“ADA”) and their related statutes and regulations. c. Section 504 prohibits discrimination based on disability in any program or activity receiving federal financial assistance. The ADA prohibits a place of public accommodation from discriminating based on disability. The applicable laws and regulations may be examined in the office of the ADA Compliance Coordinator. The Compliance Coordinator has been designated to coordinate the efforts of the Institute to comply with Section 504 and ADA. ADAComplianceCoordinator:JasonHo 1641N.FirstStreet SanJose,CA95112 (650) 425-9673 [email protected] 2. RequestsforAccommodation a. Individuals with disabilities requesting reasonable accommodation must contact the ADA Compliance Coordinator. Disclosure of a disability or a request for accommodation made to a faculty or staff member besides the ADA Compliance Coordinator will not be treated as a request for accommodation. However, if a student discloses a disability to faculty or staff members, they mustdirectthestudenttotheADAComplianceCoordinator. b. TheADAComplianceCoordinatorwillprovideastudentorapplicantwithanAccommodation RequestForm. c. Reasonable accommodations are available for students and applicants with appropriate disability documentation. Such documentation should specify that a student has a physical or mental impairment and how that impairment substantially limits one or more major life activities. Generally, the supporting documentation must be dated less than three (3) years from the date a student requests a reasonable accommodation and must be completed by a qualified professional specializing in the student’s disability, as enumerated below. Table 21. Disability Qualified Professional Physical disability MD,DO Visual impairment MD,ophthalmologist,optometrist Mobility, orthopedic impairment MD,DO Hearingimpairment MD,Audiologist(Au.D.) 144

*Audiologyexamshouldnotbemorethanayear old Speechandlanguageimpairment Licensed speech professional Learning disability Ph.D. Psychologist, college learning disability specialist, other appropriate professional Acquiredbrainimpairment MDneurologist,neuropsychologist Psychological disability Psychiatrist, Ph.D. Psychologist, LMFT, or LCSW ADD/ADHD Psychiatrist; Ph.D. Psychologist, LMFT, or LCSW Otherdisabilities MDwhopracticesorspecializeswithinthefieldof theparticular disability. Documentation used to evaluate the need and reasonableness of potential accommodations may include the following: ● Alicensedprofessional’scurrentmedicaldiagnosisanddateofdiagnosis ● Evaluation of how the student’s disability affects one or more of the major life activities andrecommendations ● Psychologicalandemotionaldiagnostictests ● Functionaleffectsorlimitations of the disability ● Medicationsandrecommendationstoalleviatetheeffectsorlimitations. The Institute may request additional documentation as needed. At its discretion, the Institute may waive the requirement for medical documentation to support accommodation requests that relate to obvious impairments and are de minimis (unimportant) in nature. d. After the ADA Compliance Coordinator receives the Request Form and the required documentation, they will engage the student or applicant in an interactive process to determine reasonable accommodations. e. If the student or applicant is denied the requested accommodation, they may file a grievance using the Grievance Process below. They also may file a complaint with the U.S. Department of Education’s Office for Civil Rights or a similar state entity. f. The Institute will make appropriate arrangements to ensure disabled individuals are provided other accommodations, if required, to participate in this grievance process. The ADA Compliance Coordinator will be responsible for such arrangements. 3. GrievanceProcess a. TheInstitute has adopted an internal grievance procedure, providing prompt and equitable resolution of complaints alleging any action prohibited by Section 504 of the ADA. b. Anyone who believes they have been subjected to discrimination based on disability, including disagreements regarding requested accommodations, may file a grievance under the procedure outlined below. The Institute will not retaliate against anyone who files a grievance or cooperates in thegrievanceinvestigation. c. Procedure i. Grievances must be submitted to the ADA Compliance Coordinator Jason Ho 1641N.FirstStreet SanJose,CA95112 (650) 425-9673 [email protected] Grievances must be submitted to the ADA Compliance Coordinator within thirty (30) days of the person filing the grievance becoming aware of the alleged discriminatory action. 145

ii. A complaint must be in writing, containing the name and address of the person filing it. The complaint must state the problem or action alleged to be discriminatory and the remedy or relief sought. iii. The ADA ComplianceCoordinator(ortheirtraineddesignee)shallinvestigatethecomplaint and allow all interested individuals to submit relevant evidence. The Complainant may also present witnesses relative to the complaint. The ADA Compliance Coordinator will maintain thefiles and records of such grievances. iv. All reasonable efforts will be made to provide a written determination to the student or applicant within 30 days of filing. The ADA Compliance Coordinator will advise the student and provide an update about the investigation status should a written decision not be made within 30 days of the filing. The student may also contact the ADA Compliance Coordinator at reasonable intervals to inquire about the investigation status. v. The person filing the grievance may appeal the decision of the ADA Compliance Coordinator by writing to the following: FredFaridian Vice President, Campus Operations 1641N.FirstStreet SanJose,CA95112 (650) 931-6684 [email protected] within 15 days of receiving the ADA Compliance Coordinator’s decision. The Chief Operating Officer shall issue a written decision responding to the appeal no later than 30 daysafter its filing. vi. Theavailability and use of this grievance procedure do not prevent a person from filing a complaint of discrimination based on disability with the U. S. Department of Education’s Office for Civil Rights and a similar state agency. vii. TheInstitute will take all steps to prevent the recurrence of any harassment or other discrimination and to correct discriminatory effects where appropriate. ConsumerProtection A student receiving a loan is responsible for repaying the loan amount, including interest, less the refund amount. If the student receives federal financial aid funds, the student is entitled to a refund of the money not paid from federal aid programs. Gurnick Academy of Medical Arts has not entered into a transfer or articulation agreement with any other college or university. Gurnick Academy of Medical Arts does not have a pending petition in bankruptcy, is not operating as a debtor in possession, and has not filed a petition within the preceding five (5) years. Neither has it had a petition in bankruptcy filed against it within the preceding five (5) years that resulted in reorganization underChapter11oftheUnitedStatesBankruptcyCode. As a prospective student, you must review this catalog before signing an enrollment agreement. You are also encouraged to review the School Performance Fact Sheet, which must be provided before signing an enrollment agreement. The student may direct questions not satisfactorily answered by this catalog or Gurnick Academy of Medical Arts to the Bureau for Private Postsecondary Education at 1747 North Market, Suite 225, Sacramento, CA 95834 or P.O. Box 980818, West Sacramento, CA 95798-0818, www.bppe.ca.gov, toll-free telephone number (888) 370-7589 or by fax (916) 263-1897. 146

ACADEMICINTEGRITY Gurnick Academy of Medical Arts students must maintain integrity in all academic pursuits. These include writing papers, examinations, assignments, records, and other details relative to the assessment of student performance. Integrity and honesty are essential qualities of all medical workers. The faculty does not want dishonest students since that attitude and perspective risk patients’ health and lives. Any dishonesty regarding these matters is subject to censure or penalty (including but not limited to expulsion) proportionately to the seriousness of the action. Dishonesty includes: ● Copyinganswersofanotherpersonorindividualsduringanexamination, ● Secreting(hiding)unauthorizedmaterialstoassistinanexamination, ● Plagiarism, taking as one’s original statements those of another without giving due credit to the author, even though such material may have been restated in one’s own words, ● Fraudulently obtaining test information, falsifying records, transcripts, recommendations, or other documentsindicativeofstudentqualifications. Gurnick AcademyofMedicalArtsalsoconsidersthefollowingseriousbreachesofintegrity: ● Falsification of patient records. ● Breachofpatientconfidentiality. ● Takingpropertyordrugsfromclinicalsitesorpatients. ● Felonyconvictions. ● Endangeringpatientsduetopsychologicalimpairmentorintoxicationwithalcoholordrugs. ● Falsification of assignments to be conducted on patients or community members. ● Havingsomeoneelsecompleteyourwrittentasksandsubmittingthemasyourwork. Proportionally, the seriousness of the action, censure, and penalty may extend from a failing grade of the work in question to expulsion from the program. Ordinarily, resolving the issues lies with the faculty member and the student. ● “Statement on Cheating and Plagiarism: Cheating includes all actions by a student intended to gain an unearned academic advantage by fraud or deception. Plagiarism is a form of cheating that misuses published and unpublished works by misrepresenting the material used as one’s original work. Plagiarism includes using books, articles, class notes, web sources, & audiovisual resources. Penalties for cheating and plagiarism range from a “0” or “F” on an assignment, a course grade of “F,” and school expulsion.” ● “Statement on Disruptive Classroom Behavior: In the classroom or laboratory environment, you must respect the rights of others seeking to learn, respect the instructor’s professionalism, and honor the differences of viewpoints. Student conduct which disrupts the learning process shall not betoleratedandmayleadtodisciplinaryactionandremovalfromclass.” ● “Syllabus is Subject to Change: This syllabus and schedule are subject to change due to extenuating circumstances. If you are absent from class, you must check on announcements made while absent.” Professional Behavior Objectives 1. DemonstrateProfessionalBehavior. ● Appear at the clinical agency, whether for patient assignment or care, appropriately dressed(namepinandSchoolbadge),consistentwiththeagencydresscode. 147

● Presentaprofessionalappearanceconcerningneatnessandpersonalhygiene. ● Arrive at the clinical setting on time and notify staff and instructor(s) when leaving or returning to patient care or the agency. ● Notify the clinical agency and instructor promptly when unable to report to the clinical assignment. ● Notify the instructor of any physical or psychological conditions limiting the ability to performsafe,effective care. ● Reportforclinicalintoxication with alcohol and mind-altering drugs. ● Do not discriminate against the clients based on race, creed, national origin, physical disability, sexual preference, or disease entity. ● Actcourteouslytowardsstaff,interdisciplinary team members, and faculty. ● Avoidusingprofanelanguagewithclientsandstaff. 2. Provide Safe Care Based on Scientific Principles ● Prepareforclientcarebyacquiringtheoryandknowledgeessentialtothecareofassigned clients (e.g., prepare drug cards, calculate drug dosages, describe the treatment, research procedures, etc.). ● Implement safe carebasedonscientificprinciples(e.g., asepsis, physical and psychological injury protection, correct medicine, and administration). 3. DemonstrateEthicalBehavior ● Maintainconfidentialityofall client, family, and agency information. ● Informtheinstructorandstaffofanyunsafepracticesobservedintheclinicalsetting. Failure to comply with these objectives will result in a failing grade for the work in question or expulsion from theprogram. PROGRAMDELIVERY The instructional delivery for Gurnick Academy of Medical Arts programs is either a blended format or full-distance education. For blended programs (A.O.S. in RC, A.O.S. in RT, A.O.S in CUT, A.O.S in VUT, A.O.S. in UT, A.S. in MRI, A.S. in PTA, A.S. in Nursing, A.S. in VN, A.S. in RT, A.S. in NM, B.S. in Nursing, DA, DXA, MA, XTMAS, VN), clinical/practicum hours are completed at an assigned clinical site(s). Simultaneously, lectures and labs may be held in a distance education format or on campus through direct classroom instruction. The A.S. in NM, B.S. in DMI, B.S. in RT, and MSN programs are full distance education. Limited online and hybrid courses are available for prerequisite courses. ELECTRONICBOOKS Disbursementsfornon-termprogramsaremadefollowingtheSAPevaluationandthedisbursementreview. Students must meettheSAPrequirementsandcompletetheclockorcredithoursandweeksinthepayment period for the scheduled disbursement to be made. Educational materials, including books, are distributed both digitally and physically. While the primary methods involve digital distribution, physical books are available through specific programs. Per federal regulations set by the U.S. Department of Education, students are not required to use electronic books (e-books) and may request to opt out of any e-book services. For further details regarding the opt-out process, timeline, and booklists, please see an Admission Advisor or the Program Director. 148

GENERALEDUCATION,TECHNICALEDUCATION&PROFESSIONALEDUCATION General Education courses are required of all students pursuing an Associate or Bachelor level program. General Education courses are identified by italic letters and numbers. General Education prepares students to think broadly and have the general skills for life needed in the ever-changing world. General Education courses assist students in building a foundation for Technical and Professional Education and developing habits to pursue lifelong learning. Technical Education within the concentration for which the degree is awarded is designed to assist students in developing the skills, attitudes, and knowledge necessary for immediate job opportunities in their chosen field of study. Furthermore, Technical Education allows students to be technically prepared upon graduation and developlifelong learning habits. Professional education requires students to think critically and master complex knowledge and skills through formal education and practical experience. Professional education is subject to strict codes of conduct, enshrining rigorous ethical and moral obligations. Professional standards of practice and ethics for a particular field are typically agreed upon and maintained through widely recognized professional associations. General education requirements may vary among programs. Some programs may require taking General Education courses, advancing to technical and professional courses, or being accepted. Others may intersperse general education throughout the program. ENGLISHINSTRUCTION Gurnick AcademyofMedicalArtsdoesnotofferEnglishasaSecondLanguage.AllinstructionoccursinEnglish. STANDARDSOFSATISFACTORYACADEMICPROGRESS For students to be considered in good academic standing, they must be making Satisfactory Progress while pursuing their program of study. Students must achieve a level of competence in all didactic and laboratory coursework. The clinical environment is consistent with the expertise required to pass the licensing exams. Satisfactory Progress measurements consist of Qualitative and Quantitative Measurements. Qualitative and Quantitative Measurements are measured when the student has attended the scheduled clock hours of each payment and after each program-required module. The Grade Point Average and the Rate of Progress/Passed Measurementarethencalculated. Qualitative Measurements The Qualitative Measurement portion consists of a student’s grades, calculated into a cumulative Grade Point Average (GPA). The GPA is calculated on a weighted scale, using course hours and quality points based on the course’s final grade. The GPA is the calculated average course grades for the entire program. A student must maintain a minimumGPAof2.00ora“C”tobeconsideredtobemakingSatisfactoryProgress. Students must obtain 75% in module I, 77% in module II, and 80% in modules III and IV for the Vocational Nurseprogram. Students must obtain an 80% (B) in each course for the Master of Nursing Nurse program. 149

For courses that are paired, students must successfully pass both courses. A failure in one of the courses constitutes a failure in the paired course(s). Both courses will have to be retaken at the same time. Thegradingsystemisdefinedasfollowsforallprograms. Table 22. Qualitative Measurements. Letter Grade NumericGrade Description Legend Quality Points A 90–100% Excellent 4 B 80–89% Good 3 C 75–79% Satisfactory 2 D 65–74% Unsatisfactory 1 F 0–64% Failure 0 P Pass (Clinical) N/A — F Fail (Clinical) N/A — W Withdrawn 0 — I Incomplete 0 — R Repeat N/A — T Transfer Credit N/A — TO Tested Out N/A — The student GPA calculation is weighted based on the number of quality points earned. Quality points earned are determined by the number of hours assigned to a particular course multiplied by the quality points awarded for the letter grade earned in this course. The total quality points are divided by the total hours completedtodeterminetheGPA. For example, a course is defined as being 24 clock hours, and the final grade received is a “C.” The chart above illustrates that the “C” grade is worth 2.00 quality points. For a 24-hour course, the total number of quality points awarded would be 24 times 2.00 or 48 total quality points. The total calculated quality points are then divided by the number of clock hours completed to determine the GPA. Didactic and laboratory courses with grades of “A,” “B,” “C,” “D,” and “F” enter into the GPA calculation. Courses with grades of “A,” “B,” “C,” and “D” are also included in the Rate of Progress/Passed Measurement calculation as hours attempted and as hours earned. Didactic and laboratory courses with an F grade are also included in the Rate of Progress/Passed Measurement calculation as hours attempted but not as hours earned. A “P” grade is given for courses designated as pass/fail. A grade of “P” does not enter into the GPA calculation. A grade of “P” is included in the Rate of Progress/Passed Measurement calculation as attempted and earned hours. 150

An “F” grade is given for courses designated as pass/fail and does not enter into the GPA calculation. A clinical course with an “F” grade is included in the Rate of Progress/Passed Measurement calculation as hours attemptedbutnotashoursearned. A “W” grade is listed on the transcript for any course a student formally withdraws from before the scheduled course ends. Grades of “W” are not entered into the GPA calculation. A grade of “W” is included in the Rate of Progress/Passed Measurementcalculationathoursattemptedbutnotashoursearned. An “I” grade is listed on the transcript for courses that have not been completed. A grade of “I” indicates that the student was in attendance for the entire term but has not completed all necessary coursework or homework to receive a punitive grade. Should missing coursework not be made up within the required time frame, the grade of “I” will be replaced with an “F.” Should a student receive a grade of “I” and successfully undergo the remediation process, the course grade will be changed to “C.” Should a student receive a grade of I and not be placed on remediation, the course grade will be changed to a punitive grade. A grade of “I” does not enter into the GPA calculation. A grade of “I” is included in the Rate of Progress/Passed Measurement calculation as attempted but not earned credits. An “R” grade is given if a student repeats a course. The grade received in the most recent course completion will be used to calculate the GPA. Upon receiving a punitive grade for the repeated course, the original grade will be changed to an “R.” A grade of “R” is not entered into the GPA calculation. A grade of “R” is used to calculate the Rate of Progress/Passed Measurement as attempted and hours earned. A “T” grade is listed on the transcript for any course a student took at another institution accepted by Gurnick Academy of Medical Arts. Courses with a grade of “T” are listed on the transcript to identify courses accepted into the program of study to satisfy graduation requirements. A grade of “T” does not enter into the GPA calculation. A grade of “T” is not included in the Rate of Progress/Passed Measurement calculation as hours attemptedorearned. A “TO” grade is listed on the transcript for any course successfully tested out of at Gurnick Academy of Medical Arts. A grade of “TO” does not enter into the GPA calculation. A “TO” grade is included in the Rate of Progress/Passed Measurementcalculationasattemptedandearnedhours. Quantitative Measurements The Quantitative Measurement portion consists of a student’s satisfactorily completed program hours, as by a Rate of Progress/Passed Measurement calculation. The Rate of Progress/Passed Measurement is the percentageofcompletedhoursoverattemptedhours. The Rate of Progress/Passed Measurement has two components: theattemptedandactualhoursearned.The actual hours earned are divided by the attempted hours to determine the student’s Progress/Passed measurementrate. The maximum timeframeforcompletingprogramsofstudyatGurnickAcademyofMedicalArtsis150%ofthe scheduled program length. Programs are measured in both clock and credit hours. However, clock hours will calculate the maximum time frame and the Rate of Progress/Passed Measurement. Periods of non-enrollment are not considered in calculating the maximum time frame. Any student who has not reached program completion by the maximum time frame will be expelled from Gurnick Academy of MedicalArts. Table 23. Quantitative Measurements 151

Midpointofthe Maximum Clock Hours Program MaximumTime TimeFrame in Program Frame (credit hours) Associate of Occupational Science in Cardiac 1,792 1,344 2,688 Ultrasound Technology (A.O.S. in CUT) Associate of Occupational Science in Respiratory 1,446 1,084.5 2,169 Care(A.O.S. in RC) Associate of Occupational Science in Radiologic 2,923 2,192.25 4,384.5 Technology(A.O.S. in RT) Associate of Occupational Science in Ultrasound 2,386 1,789.5 3,579 Technology(A.O.S. in UT) Associate of Occupational Science in Vascular 1,784 1,338 2,676 Ultrasound Technology (A.O.S. in VUT) Associate of Science in Magnetic Resonance 1,886 1,414.5 2,829 Imaging(A.S. in MRI) Associate of Science in Nuclear Medicine 2,646 1,984.5 3,969 Technology(A.S. in NM) Associate of Science in Nursing – Generic (ADN) 1,830 1372.5 2,745 Associate of Science in Nursing – AP (LVN-RN) 645 483.75 967.5 Associate of Science in Physical Therapist Assistant 1,353* 1,014.75 2,029.5 (A.S. in PTA) Associate of Science in Radiologic Technology (A.S. 2,974 2,230.5 4,461 in RT) Associate of Science in Vocational Nursing (A.S. in 2,070 1552.5 3,105 VN) Bachelor of Science in Diagnostic Medical Imaging 765 573.75 1,147.5 (B.S. in DMI) Bachelor of Science in Nursing – Generic (BSN) 2,505 1,878.75 2,757.5 Bachelor of Science in Nursing – AP (LVN-BSN) 1,335 1,001.25 2,002.5 Bachelor of Science in Nursing – RN-BSN (RNBSN) 405* 303.75 607.5 Bachelor of Science in Radiation Therapy (B.S. in RT) 3,100 1,550 4,650 BoneDensitometryTechnician(DXA) 56 42 84 Dental Assistant (DA) 946.5 709.88 1,419.75 MasterofScienceinNursing–BSN-MSN(BSNMSN) 540 405 810 MedicalAssistant (MA) 948.5 711.38 1,422.75 Vocational Nurse (VN) 1,570 1,177.5 2,355 X-ray Technician with Medical Assistant Skills 1,341 1,005.75 2,011.5 (XTMAS) *ThesenumbersreflectonlytheclockhoursforGurnickAcademyofMedicalArtsTechnical/ProfessionalCourses. 152

CLASSSTANDING Undergraduatesareclassified by the number of credits (institutional and transfer) earned. Table 24. Class Standing SemesterCreditHours QuarterCreditHours Freshman:0-24 Freshman:0-37.49 Sophomore:25-48 Sophomore:37.5-73.49 Junior: 49-72 Junior: 73.5-109.49 Senior: >73 Senior: >109.5 ATTENDANCE–ABSENT–TARDINESS–DROP Students are expected to attend all classes as scheduled. All efforts should be made to attend all classes. If a student is absent due to illness or any other reason, they must notify Gurnick Academy of Medical Arts in advancewheneverpossible.Thestudent’sinstructormustapproveallabsences. Program lengths are calculated, excluding any holiday and vacation times. Class times may be rescheduled on an alternate day of the week (Sunday through Saturday) to ensure program completion is on time and the required hours are fulfilled. Absent ● Studentswhoarrivemorethan15minutesafterclassbegins. ● Studentswholeavemorethan15minutesbeforeclassends. ● Studentswhoreturnfromthebreakmorethan15minutesafterclassbegins. ● Three(3)tardiesareequivalenttoone(1)absence. Tardy ● Studentsthatarriveone(1)to15minutesafterclassbegins. ● Studentsleaveclassone(1)to15minutesbeforeclassends. ● Studentsreturnfrombreakone(1)to15minutesafterclassbegins. Drop ● Studentswhomissasignificantportionofanycoursewithinaprogramwillbeexpelled. ● Unexcused and excused absences without approval and completed make-up work cannot exceed 10%whentheRateofProgress/PassedMeasurementiscalculated. Please see the table Number of Unexcused Absences for more details. To find out how and when the Rate of Progress is calculated, contact your Student Service Representative. The table Number of Unexcused Absences outlines the number of unexcused absences per course (otherwise noted), resulting in various disciplinary measures. Table 25. Number of Unexcused Absences #ofAbsencesResulting #ofAbsencesresulting #ofAbsences Course Program in Student Warning in Disciplinary resulting in Type Notification Probation Expulsion Didactic 2* 3* 4* MA 153

Clinical 2 3 4 Didactic 1*** 2*** 3*** DA Clinical 1*** 2*** 3*** ADN, Didactic 1 3 4** LVN-RN, BSN, Clinical 1 3 4** LVN-BSN Didactic 2 3 4 A.O.S. in RC Clinical 0 1 1 A.O.S. in UT, Didactic/La 2* 3* 4* A.O.S. in CUT, b A.O.S. in VUT Clinical 2* 2* 3* A.S. in MRI, Didactic A.S. in PTA, A.S. in RT, 2 3 4 Clinical A.O.S. in RT, A.S. in NM, B.S. in RT Didactic 2 3 4 Clinical VN VN120 VN420 1 2 3 VN440 Online Course (see A.S. in VN below) Online Course (see B.S. in DMI below) RN-BSN, Online Course (see BSN-MSN below) Didactic DXA, 2 3 4 XTMAS Clinical *Thesenumbersareconsideredtobeperthree(3)consecutivecourses,notpercourse **Either in Didactic or Clinical or a total of both Didactic and Clinical ***These are total absences allowed for the entire program, either in Didactic or Clinical or a total of both Didactic and Clinical OnlineCoursesAttendance,Participation,andAbsences Attendance Attendance of this class is mandatory and under the school policy as printed in the current school catalog. Students’ attendance is tracked through the submission of online activities and assignments. Clock hour tracking for online courses may be accomplished in different ways. The student must log in on a specific date andtimetoparticipateinsynchronousactivities. The interaction is recorded for documentation. 154

For fully asynchronous Online classes, students must complete the lecture discussions, both responding to the prompt and responding to others. A student who does not make the minimum number of posts in the discussion for each lecture will be marked absent. Absences are made up by completing the discussion requirements. The learning management system tracks asynchronous hours through an activity log. The log records a student’s time on a particular page or activity and can be pulled at any time for review. The absence of more than 10% of the course (more than two (2) class periods) may result in a student being placed on academic probation and is grounds for expulsion from the program. All absences must be made up before course completion. Participation Youwill be expected to participate in the Discussion sections. Ask questions, provide comments, and share yourexperiencesandknowledgewiththerestoftheclass.Yourparticipationinthisclassisrequired.Please visit “Netiquette” for details on proper participation in the Class Forum. Instructor Absence An email will inform the students of class cancellations and any assignments that must be completed before the next class if the instructor is absent. Every attempt will be made to provide a substitute rather than cancel aclass. StudentAbsence Thefollowingabsencesaretheonlyexcusedabsences.Studentsmustprovideproofofexcusedabsences: ● MedicalEmergency ● JuryDuty ● FamilyEmergency* ● Bereavement ● SubpoenaedCourtDates ● Naturalization/Citizenship Appointments ● MandatoryWorkOrientation ● ReserveDuty *If you are the sole responsible person for a child or dependent adult and there is a medical emergency, you mustprovidewrittendocumentationfromthephysician. Medical clearance must be provided to and approved by the program coordinator before the student can return to the clinical setting. ContinuingEducationCoursesAttendance-Tardiness-DropPolicy Please read this policy on our website as it differs from the above-stated policy. Make-upGuidelines The table Make-upAssignmentsDeadlinessummarizesthemake-upguidelinesperprogram.Allabsencesmust be made up within the period specified in the table or by the end of the course, whichever comes first. The student’s responsibility is to ensure that a make-up plan of action for each absence is completed within the period specified in the table and documented on the didactic make-up and clinical make-up form. All make-up forms must be wholly and accurately completed with all required signatures for all missed hours before the credit for make-up hours is granted. 155

Table 26. Make-up Assignments Deadlines Make-upPlanofAction Didactic Absence Make-up Clinical Absence Make-up Program Establishment Deadline for AssignmentDue AssignmentDue Clinical and Didactic Absences A.O.S. in UT, A.O.S. in CUT, Withinseven(7)days Within30Daysfromthe A.O.S. in VUT, upon ReturnfromAbsence.* DateofAbsence.* A.S. in MRI, Within30Daysfromthe VN DateofAbsence.* A.S. in PTA, Immediatelyupon Returnfrom Withinseven(7)Days DA, Absence. fromReturnofAbsence.* MA ADN, LVN-RN, A.S. in VN, BSN, Withinseven(7)daysupon Within14daysfromthe Within14daysfromthe LVN-BSN, return from Absence. dateofAbsence. dateofAbsence. RN-BSN, BSN-MSN, B.S. in DMI A.S. in RT, A.O.S. in RT, A.O.S. in RC, ImmediatelyuponReturnfrom Withinfive (5) Days from Bytheendofthecurrent A.S. in NM, Absence. ReturnofAbsence. externship course. B.S. in RT, DXA, XTMAS *Orbytheendofthecourse,whichevercomesfirst. Associate of Occupational Science in Respiratory Care Program (A.O.S. in RC) To meet the criteria for attendance and the specific course objectives, students must arrange make-up time for missed hours with the instructor for all instructor-approved absences. Make-up theory hours can include case studies, independent study, written examination, attendance at seminars or workshops, auto-tutorial laboratory, and research reports. Make-up clinical hours require scheduling additional time at the assigned facility with the assigned clinical instructor, and progression in the program will be permitted once reconciled. Associate of Science in Physical Therapist Assistant Program (A.S. in PTA) To meet the criteria for attendance and the specific course objectives, students must arrange a make-up time for missed hours with the instructor for all instructor-approved absences. Make-up theory hours can include case studies, independent studies, written examinations, attendance at seminars or workshops, auto-tutorial laboratory, and research reports—make-up clinical hours require scheduling additional time with the assigned clinical instructor at the facility. Vocational Nurse (VN) Program All Vocational Nurse students must complete all required theory and clinical hours to graduate. When possible, theinstructor must approve all absences in advance. Approval for all absences is at the instructor’s discretion. To meet the criteria for attendance and the specific course objectives, students must arrange a make-up time 156

for missed hours with the instructor for all instructor-approved absences. Make-up theory hours can include case studies, independent studies, written examinations, attendance at seminars or workshops, auto-tutorial laboratory, and research reports. Make-up clinical hours can consist of performance evaluation(s) in the skills laboratory or additional time in the clinical area with clients and patients. ACADEMICPROBATION/REMEDIATION Please read this policy and its programmatic sections, as there are slight policy variations per program. The table Remediation/Probation Plan Details summarizes the Academic Probation/Remediation and Disciplinary Probation guidelines per program. Table 27. Remediation/Probation Plan Details MaximumTimeFrameof RemediationPlan ProbationPlan RemediationPlan Establishment Establishment Completion Program #ofbusinessdaysfrom #ofbusinessdays–academic #ofcalendardaysfromthe thecoursecompletion probation/disciplinary dateofissuance date probation A.S. in PTA, 2 3 3 A.O.S. in RC A.O.S. in UT, A.O.S. in CUT, 3 14 3/module A.O.S. in VUT A.S. in MRI A.S. in NM A.S. in RT 5 5 A.S. in VN 5 B.S. in RT MA DA 21 VN 5 ADN,LVN-RN Disciplinary only BSN,LVN-BSN, RN-BSN*, 5 21 BSN-MSN B.S. in DMI A.O.S. in RT NextBusinessDay 5 3 DXA, NextBusinessDay 5 3 XTMAS *Applies to General Education courses only. Duration of Probationary Period: two (2) probationary periods are the maximum allotted per course, only if the problemisnotsimilar(academicversusdisciplinary). The Gurnick Academy of Medical Arts is committed to the success of each student. We recognize there are 157

times and circumstances when students may have poor academic, laboratory, or clinical performance. Gurnick Academy of Medical Arts monitors students’ performance and implements a progressive educational performancepolicytokeepthemontrack. The clinical practicum and clinical rotation courses cannot be remediated. Students who fail a clinical practicum or clinical rotation course will be expelled from the program. All students who receive a non-passing grade in any didactic or laboratory course will be placed on remediation. Please review the Qualitative Measurements section for more information on grading. To lift the remedial status, students must complete the corrective plan. If the student decides not to finish the remedial plan for any reason or does not complete the remediation plan, the student receives a failing grade for the course and will be expelled for academic reasons. The remedial action plan will be developed by a Designated School Official with student collaboration (student collaboration is required for the successful result of the corrective plan) and finalized within the maximum time frame specified in the table above. The table above shows the maximum time frame for completing a remedial action plan. The remedial plan aims to improve the student’s chance of completing the program and strengthen areas of concern or weakness. Students may be required to attend remediation sessions with the instructor and complete remediation assignments as per the remediation plan. The remediation coursework is designed per theindividual student’s situation. The remediation grade is not calculated into the overall course grade or considered “extra credit.” Students who pass the remediation are deemed to receive a passing grade of “C” in that course. The student must adhere to and complete the action plan to remain in the program. Failure to attend or to complete remediation within the maximumtimeframewillresultinexpulsionfromtheprogramforacademicreasons(pleaseseethe Re-Enrollment policy for more details). Students on remediation are not eligible for Federal Student Aid. Once the student completes the remediation plan and receives a passing grade of “C” for the course for which the student was placed on remediation, the student will regain eligibility for Federal Student Aid. Students on remediation are not eligible to be placed on Leave of Absence (LOA). Students may be placed on remediation only for a maximum of two (2) courses per module or semester as necessary and are not to exceedthree(3)timesfortheprogramduration. If the student has completed two (2) remediations per module/semester or three (3) remediations total and still obtains a non-passing grade in any remaining courses, the student will be expelled from the program for academicreasons. Additional information for Vocational Nurse Program (VN) CourseVN440cannotberemediated.ForModule1,thepassinggradeis75%.ForModule2,thepassinggrade is 77%. The minimumpassinggradeforModules3and4is80%.Studentswhoscorelowerthan60%arenot eligible for remediation. Additional information for X-ray Technician with Medical Assistant Skills (XTMAS) and Bachelor of Science in Diagnostic Medical Imaging (BSDMI) Students whoscorebelow60%arenoteligibleforremediation. 158

Additional information for Associate of Science in Respiratory Care (A.O.S. in RC) A score less than 75% (C) in any course (theory/didactic/clinical) is considered a failing grade. Students who do not achieve the minimum 75% (C) grade in theory and didactic courses may be eligible for remediation if their score is 60% or greater. Students who score below 60% are not eligible for remediation. Any student who does not complete a clinical externship will automatically fail the clinical course. There is no remediationavailable for clinical courses. Students who fail any course are immediately withdrawn from the program. Students may reenter the program only whenthecourseisofferedinthesubsequentcohort.* *If students fail a course, they may be eligible to join a subsequent cohort if space permits. Students must retake this course within two years. Any time in the past two (2) years, the student’s retention of previously learned material must be deemed competent by the Program Director via direct observation of skills check or comprehensiveexam. Additional information for Associate of Science in Physical Therapist Assistant (A.S. in PTA) Students maybeplacedonacademicprobationduringanycourse(didactic,lab,orclinicalevaluations)ifa gradeoflessthana“C”isachieved. If a student is placed on academic probation, they must meet with the instructor and Program Director or designeewithinthetimeframespecifiedintableRemediation/ProbationPlanDetailstopreparea probationary plan of action explicitly stating expectations that must be met during the probationary period. Theprobationaryplanofactionidentifiestheareasofconcernandthegoalsforimprovement.Theprobation plan of action is designed individually and is not calculated into the overall course grade, nor is it considered “extra credit.” The consequence of failing to meet the level of expectations and failing to receive a passing gradeforthecoursewillultimatelyresult in a remedial plan of action. Animprovementplanwillbeinitiatedwithspecificduedates.Academicprobationarystatusisliftedoncethe student has met the expectations defined within the probationary plan of action and has completed the course in satisfactory academic standing. After being placed on probation, the student receives a final passing grade for the course. This final grade will be reflected on the student’s transcript. Additional information for Associate of Occupational Science in Cardiac Ultrasound Technology (A.O.S. in CUT), Associate of Occupational Science in Radiologic Technology (A.O.S. in RT), Associate of Occupational Science in Ultrasound Technology (A.O.S. in UT), Associate of Occupational Science in Vascular Ultrasound Technology (A.O.S. in VUT), Associate of Science in MRI (A.S. in MRI), Associate of Science in Nuclear MedicineTechnology(A.S.inNM),andAssociateofScienceinRadiologicTechnology(A.S.inRT)Programs. Students may beplacedonremediationonlyforamaximumof2coursespermoduleandarenottoexceedthe total of two (2) times throughout the entire duration of the program. Students may be placed on academic probation during any course (didactic, lab, or clinical evaluations) if their final score is 60% or greater. Students who score below 60% are not eligible for remediation. If a student is placed on academic probation, they must meet with the instructor and Program Director or designee within the time frame specified in table Remediation/Probation Plan Details to prepare a probationary plan of action explicitly stating expectations that must be met during the probationary period. Theprobationaryplanofactionidentifiestheareasofconcernandthegoalsforimprovement. 159

The probation plan of action is designed individually and is not calculated into the overall course grade, nor is it considered “extra credit.” The consequence of failing to meet the expectations and failing to receive a passing gradeforthecoursewillultimatelyresult in the offer of a remedial action plan. An improvement plan will be initiated with specific due dates. Academic probationary status is lifted once the student has met the expectations defined within the probationary plan of action and completed the course in satisfactory academic standing. The student receives a final passing grade for the course after being placed on probation. This final grade will be reflected on the Student’s transcript. Additional information for Associate of Science in Nursing (ADN) and Bachelor of Science in Nursing (BSN) Programs Ascorelessthan75%(C)inanycourse(theory/didactic/clinical)isconsideredafailinggrade.Studentswhodo notachievetheminimum75%(C)gradewillbewithdrawnfromtheprogram.Allclinicalcoursesarepaired courses with a corresponding theory course. Failure in one paired course equals failure in both courses. The courses must be retaken and passed concurrently. There is no remediation available for the core nursing courses. Students who score below 60% are not eligible for remediation for the general education courses. Additional information for Bachelor of Science in Radiation Therapy (B.S. in RT) Students can be placed on clinical or didactic probation to improve their understanding of course material, technical skills below acceptable levels of competence, or unprofessional behavior in the clinical setting. If a student is placed on clinical probation, they must meet with the instructor and Program Director or designee within the time frame specified in table Remediation/Probation Plan Details to prepare a probationary plan of action explicitly stating expectations that must be met during the probationary period. The probationary plan of action identifies the areas of concern and the goals for improvement. The probation plan of action is designed individually and is not calculated into the overall course grade, nor is it considered “extra credit.” A score of less than 75% (C) in any course (theory/didactic/clinical) is considered a failing grade. Students who do not achieve the minimum 75% (C) grade will be withdrawn from the program. All clinical courses are paired courses with a corresponding theory course. Failure in one paired course equals failure in both courses. Both courses must be retaken and passed concurrently. Students who score below 60% are not eligible for remediation. Any student whodoesnotcompleteaclinicalevaluationwillautomaticallyfailtheclinical course. Students may reenter the program only when the course is offered in the subsequent cohort. Additional information for X-ray Technician with Medical Assistant Skills (XTMAS), Associate of Science in Vocational Nurse (A.S. in VN), and Bachelor of Science in Diagnostic Medical Imaging (B.S. in DMI) Students whoscorelowerthan60%arenoteligibleforremediation. DISCIPLINARYPROBATION Students must adhere to Gurnick Academy of Medical Arts’ acceptable conduct and behavior. Disciplinary probation status is a consequence when a student disregards the boundaries of proper behavior outlined in this catalog and other applicable disclosures. Students who violate any Gurnick Academy of Medical Arts Programpolicies/guidelines will be placed on disciplinary probation. Written disciplinary probation is an official notice for a specified period during which a student must demonstrate conduct that conforms to Gurnick Academy of Medical Arts’ standards of conduct. Assigned discipline may include a combination of sanctions for a particular incident. Misconduct during the probationary period or violation of any conditions will result in further disciplinary action, generally expulsion. Expulsion is 160

the termination of “Student” status for an indefinite period. Please see our Re-enrollment Policy for more details. Disciplinary probation status does not prohibit a student from being placed on academic probation and remediation. Please see the summary of the Disciplinary Probation guidelines per program in the Academic Probation/Remediationpolicy. REPETITIONOFCLASSESORMODULES If students are assigned to repeat any classes or modules for any reason, they will be responsible for additional tuition payment based on the prorated hourly charges. (Ex. The total number of hours needed to repeat is multiplied by hourly charges). LEAVESOFABSENCE A Leave of Absence (LOA) is an approved absence from a program for 180 days maximum in a 12-month calendar period. Students who are approved for an LOA for less than 180 days may request an additional LOA for well-documented reasons, so long as combined, they do not exceed 180 days in a 12-month calendar period. Students may be placed on an LOA for pregnancy and academic reasons. Eligibility for an Academic LOA depends on individual student circumstances. The Academic Probation/Remediation, Re-enrollment, Pregnancy, and Financial sections provide additional information on LOA eligibility. If the student does not return by the expected return date, they will be expelled from the program, with the effective date as the student’s Last Day of Attendance (LDA). A student’s grace period may be shortened for loans received from financial aid by the amount of time spent on LOA. Gurnick Academy of MedicalArtswill award the grade of “W” for courses the student has withdrawn due to an approvedLOA. Students who are unable to continue with their program may request to be withdrawn from the program. Students will have the ability to re-enroll through the appropriate re-enrollment process when they are ready to continue. Students are strongly advised to consult their Financial Aid and Admissions Advisors before withdrawing to ensure they understand the potential implications of financial aid status, program progress, and other concerns. Pregnancy Eligible students must meet with the Program Coordinator and complete an LOA Request Form.* Students must consider the effects of an LOA on their current enrollment, academic standing, and financial aid and discuss the expected return date along with the make-up plan. The student must obtain the signatures of the Program Coordinator and the CampusDirectortofinalize the LOA approval process. Students must keep a copy of the approved LOA Form. The Program Coordinator, Campus Director, or School Official Designee will consider the individual circumstances of the student and the frequency of LOA requests during the approval process. Should the issuance of an LOA be such that it would significantly interfere with the planned completion of a program of study, appropriate actions will occur at the sole discretion of the Program Coordinator/Campus Director or designated official. *Refer to the Pregnancy Policy for more details. LOA Request Forms are available on the Gurnick Academy of 161

MedicalArtswebsite. Academic The Institution determines academic LOA and is limited to students in a non-term program who have completed at least one course while in good academic standing. Students who have received a transfer of credits with a gap of non-attendance in their program schedule may be required to take an involuntary leave to suspendstudiestemporarily. Note:Studentsinterm-basedprogramsarenoteligibleforanLOA. GRADUATIONREQUIREMENTS ThefollowingrequirementsmustbemetforastudenttograduatefromanyprogramatGurnickAcademyof MedicalArts: 1. Completionofallprogramcoursesandhours. 2. All financial obligations, including tuition and textbook charges, have been met. Program-Specific Graduation Requirements Additional Graduation Requirements for the Associate of Science in Respiratory Care Program (A.O.S. in RC) 1. Thestudentmustcompleteandverifytheminimumclinicalcompetenciesinthelabandclinicalsetting defined by the course syllabi and log into the Clinical Trac software. 2. Students must have acquired an Associate’s Degree from a CoARC Accredited program before being able to sit for the RRT exam. Additional Graduation Requirements for the Associate of Science in Radiologic Technology Program (A.S. in RT)andAssociateofOccupationalScienceinRadiologicTechnologyProgram(A.O.S.inRT) 1. The student must complete and verify the minimum clinical competencies defined by the American Registry of Radiologic Technologists® (ARRT®). 2. Students must have acquired an Associate’s Degree before taking the ARRT® exam. Additional Graduation Requirements for the Associate of Science in Nuclear Medicine Technology Program (A.S. in NM) 1. The student must have completed and verified the minimum clinical competencies defined by the AmericanRegistryofRadiologicTechnologists®forNuclearMedicineTechnology. 2. Students must have an Associate’s Degree before taking the American Registry of Radiologic Technology Nuclear Medicine Technology certification exam. Additional Graduation Requirements for the Associate of Science in Nursing Program (ADN) 1. To graduate from the Associate of Science in Nursing Program, students must successfully meet the benchmarkof90%ontheATIExitExam. Additional Graduation Requirements for the Bachelor of Science in Nursing Program (BSN) 1. To graduate from the Bachelor of Science in Nursing Program, students must successfully meet the benchmarkof90%ontheATIExitExam. Additional Graduation Requirements for the Bachelor of Science in Radiation Therapy (B.S. in RT) 1. The student must have completed and verified the minimum clinical competencies defined by the AmericanRegistryofRadiologicTechnologists®. 162

2. Students must have a bachelor’s degree before taking the American Registry of Radiologic Technology Radiation Therapy certification exam. 3. Students must complete all clinical hours as required by CDPH-RHB. Additional Graduation Requirements for the Master of Science in Nursing Program (BSN to MSN) 1. The student must have a minimum GPA of 3.0 to graduate. Additional Graduation Requirements for the Dental Assistant Program DA 1. Students must bring three (3) patients (aged 18 or above) to campus for Coronal Polishing. Each patient must complete the documentation to be reviewed and approved by a Dental Assisting program faculty memberwhocanparticipate.Thedocumentmustbereceivedbeforethescheduled Coronal Polish examination date. 2. Students must bring four (4) patients (aged 18 or above) to campus for a full set of mouth X-rays (FMX). Each patient must fill out the documentation to be reviewed and approved by a dentist, stating they can participate. The document must be received before the scheduled FMX examination date. Additional Graduation Requirements for the Vocational Nurse Program (VN) 1. The student must have completed the program exit examination. Students will be given up to two (2) attemptstocompletetheexitexam. ONLINECOURSERESPONSETIME For online courses, the institution has seven (7) days between the institution’s receipt of student lessons, projects, or dissertations and the institution’s mailing of its response or evaluation. STUDENTTECHNOLOGYACCEPTABLEUSEPOLICIES Students are responsible for actions and activities involving Gurnick Academy of Medical Arts computers, personal computers, networks, Internet services, and personal computer files, passwords, and accounts. These policies provide general direction concerning computer usage and examples of prohibited uses. The rules do notattempttodescribeeverypossibleprohibitedactivitybystudents.Studentsquestioningwhetheranactivity is prohibited are urged to contact the school administration. VIOLATIONOFCOMPUTERUSEPOLICYANDRULES Using Gurnick Academy of Medical Arts computers, networks, and Internet services is a privilege, not a right, including personal devices such as computers and mobile devices. Compliance with policies and rules regarding computer use is mandatory. Students who violate these policies and regulations may have their computer privileges limited, suspended, or revoked. Such violations may also result in disciplinary action, law enforcement referrals, and legal action. The school administration shall have the final authority to decide whetherastudent’sprivileges will be limited, suspended, or revoked based on the conditions of the situation. REQUIREDAPPLICATIONS All Gurnick Academy of Medical Arts students must have the following application installed on their computers: ● Chromebrowser ● AdobeAcrobatReader ● VitalSourcebookshelf 163

Students mayfacedisciplinary action if applications are not installed or intentionally removed. ACCEPTABLEUSES The Gurnick Academy of Medical Arts computers and Internet services are provided for educational purposes and study consistent with its educational mission, curriculum, and instructional goals. When using computers, all policies, school rules, and expectations concerning student conduct and communications apply. Students are also expected to comply with all specific instructions from teachers and other school staff when using a school or personal computer. PROHIBITEDUSES Violations of the Student Technology Acceptable Use Policy may result in disciplinary action depending on the nature of the violation. Examples of prohibited uses of technology services are: ● Accessing Inappropriate Materials – Accessing, submitting, posting, publishing, forwarding, downloading, scanning, or displaying defamatory, abusive, obscene, vulgar, sexually explicit, sexually suggestive, threatening, discriminatory, harassing, and illegal materials. ● Violating Copyrights – Copying, downloading, or sharing copyrighted materials without permission is prohibited. ● Software Copying – Unauthorized copying of software is illegal and may subject the copier to substantial civil and criminal penalties. ● Non-School-Related Practices – Using Gurnick Academy of Medical Arts school networks and Internet services for non-school-related purposes such as private financial gain, commercial, advertising, solicitation purposes, or any other personal use unrelated to the educational program or assignments. ● Unauthorized Access – Sharing passwords with other users or using other users’ passwords and accessing or using other students’ accounts. ● Malicious Use and Vandalism – Any malicious use, disruption, or harm of Gurnick Academy of Medical Arts computers, networks, and Internet services, including but not limited to hacking activities and creation/uploading of computer viruses. NOEXPECTATIONOFPRIVACY Students do not expect privacy when using the Gurnick Academy of Medical Arts computers, personal computers, or mobile devices on campus or using Gurnick Academy of Medical Arts internet resources, email, GoogleDrive,andstoredfiles. Gurnick Academy of Medical Arts reserves the right to review and monitor any emails or transmissions sent or received through its network at its sole discretion. EMAILUSAGE This information aims to ensure the proper use of the Gurnick Academy of Medical Arts email system and make users aware of what Gurnick Academy of Medical Arts deems to be acceptable and unacceptable use of its email system. Gurnick Academy of Medical Arts reserves the right to amend this policy. Concerning amendments,userswillbeinformedappropriately. SystemMonitoring You have no expectation of privacy for anything you create, store, send, or receive on the Gurnick Academy of Medical Arts computer system. Your emails can be monitored without prior notification if Gurnick Academy of 164

Medical Arts deems this necessary if there is evidence that you are not adhering to the guidelines set out in this policy. Gurnick Academy of Medical Arts reserves the right to take disciplinary action, including termination andlegalaction. EmailAccounts All email accounts maintained on our email systems are the property of Gurnick Academy of Medical Arts. Passwords should not be given to other people and must be changed once every six (6) months. The 2-factor authentication must be activated on your Gurnick email. *Email accounts are available to students for learning and communication within the Gurnick Academy of MedicalArtscommunity.Emailaccountsareprovidedonlytostudentswhoareenrolled. PrimaryMeansofCommunication Gurnick Academy of Medical Arts provided email accounts as the primary means of communication for all academy functions and between yourself and staff, instructors, and fellow students. You must check your Gurnick Academy of Medical Arts provided email every 24 hours. As necessary, official communication will only bedeliveredtoyourGurnickAcademyofMedicalArtsemailaddress. Legal Risks Email services are educational tools, and users must use this tool responsibly, effectively, and lawfully. Although email appears less formal than other written communication, the same laws apply. Therefore, users must be awareofthelegalrisksofemail: ● YouandGurnick Academy of Medical Arts can be held liable if you send or forward emails with any libelous, defamatory, offensive, racist, or obscene remarks. ● You and Gurnick Academy of Medical Arts can be held liable if you unlawfully forward confidential information. ● You and Gurnick Academy of Medical Arts can be held liable for copyright infringement if you unlawfully forward or copy messages without permission. ● YouandGurnick Academy ofMedicalArtscanbeheldliableifyousendanattachmentthatcontains avirus. By following the guidelines in this policy, the email user can minimize the legal risks involved in using email. If any user disregards the rules set out in this Email Usage Policy, the user will be fully liable, and Gurnick AcademyofMedicalArtswilldisassociateitselffromtheuserasfaraslegallypossible. Confidential Information Avoid sending confidential information by email. If you need to, please ask our staff for the secure email channel, and they will guide you on sharing this information via the encrypted email. AcceptableUse Gurnick Academy of Medical Arts students must understand and follow the Email Acceptable Use Policy for appropriate email service usage. Violations of the Email Acceptable Use Policy may result in disciplinary action dependingonthenatureoftheviolation.Examplesofprohibitedusesofemailservicesare: ● Intentionalandunauthorizedaccesstoanotherperson’semail. ● Sending or forwarding emails containing libelous, defamatory, offensive, racist, or obscene remarks. If you receive an email of this nature, you must promptly notify your supervisor. ● Attemptingtoforgeemailmessages. ● Creation and use of a false or alias account to impersonate another individual to send fraudulent communications. 165

● Distributingmaterialsinviolation of copyright law. ● Usingemailservicesforcommercialactivitiesorprofit-makingpurposes. ● Using email servicestovisit, view, or distribute internet sites or content containing obscene, sexually explicit, or profane material. ● Sendingorclickingonmaliciousemaillinks. Writing Emails ● Writewell-structuredemailsanduseshort,descriptivesubjects. ● Gurnick Academy of Medical Arts’ email style is informal. This means that sentences can be short and to the point. You can start your email with “Hi,” or “Dear,” and the person’s name. Messages can be ended with “Best Regards.” However, using Internet abbreviations and characters such as smileys is discouraged. ● Usethespellcheckerbeforeyousendoutanemail. ● Donotsendunnecessaryattachments.Compressattachmentslargerthan2Mbeforesendingthem. ● Donotwriteemailsincapitals. ● DonotuseCC:orBCC:fieldsunlesstheCC:orBCC:oftherecipientisawarethatyouwillbecopying amailtothemandknowswhataction,ifany,totake. ● Stateclearlywhatactionyouexpecttherecipienttotakeifyouforwardanemail. ● Only send emails where the content could be displayed on a public notice board. If they cannot be displayed publicly in their current state, consider rephrasing the email, using other means of communication,orprotectinginformationusingapassword(seeconfidential). ● Onlymarkemailsasnecessaryiftheyareessential. Best Practices Gurnick Academy of Medical Arts considers email an essential means of communication. It recognizes the significance of proper email content and prompt replies to convey a professional image and deliver good customer service. Therefore, Gurnick Academy of Medical Arts requests users to adhere to the following guidelines: Confidential Information ● Avoid sending confidential information by email. If you need to, please ask our staff for the secure email channel, and they will guide you on sharing this information via the encrypted email. Malware/Viruses ● Students should avoid opening files from unknown senders or files they are not expecting, as they could contain malicious code. ● Studentsshouldbecarefultosendfilesthatareknowntobesecure. Replying to Emails ● Emailsshouldbeansweredwithin24hours. Newsgroups ● Users must request permission from their supervisor before subscribing to a newsletter or newsgroup. Maintenance ● Delete any email messages you do not need to archive and set your email client to empty your “deleted items” upon closing. 166

EquipmentLossesandDamages The student is responsible for the losses or accidental damage to the personal computer, mobile devices, loaner devices, library equipment, equipment purchased through Gurnick Academy of Medical Arts, or any equipment or devices provided by Gurnick Academy. StudentTechnologySecurityPolicy ● Students may not share or reveal personal information such as login names, passwords, full names, addresses, telephone numbers, or social security numbers on the Internet. ● The students may not use someone else’s login name and password on the school or personal equipment. ● Students must notify their instructor if they access information or messages that are threatening, inappropriate, or cause discomfort. ● If you notice a security threat, do not demonstrate the problem to others or attempt unauthorized access to the material. Any student who attempts to breach system security, cause a system security breach, or fails to report a system security matter will be subject to disciplinary and legal action and have their computer privileges limited, suspended, or revoked. ● The Gurnick Academy of Medical Arts system security is a high priority. Students who identify security threats must inform their instructor immediately. TheImportanceofStrongandSecurePasswords Passwords are essential to computer security. In addition to creating a secure password, users should learn to safeguard and use it wisely. We recommend using a password manager if you need help remembering your password. ● Passwordsshouldchangeregularly,atleasteverysix(6)months. ● Useadifferentpasswordforeverything. ● Itsignificantly increases the risk of your accounts being compromised. ● Donotshareyourpasswordwithanyone. ● Donotwriteorstorepasswordsonlinewithoutencryption. ● Donotrevealpasswordsinemail,chat,orotherelectroniccommunication. ● Donotenterpasswordsonquestionnairesorsecurityforms. ● If an account or password compromise is suspected, report the incident immediately to your instructor and Gurnick IT department. GeneralPasswordConstructionStandards 1. Contain at least three (3) of the five (5) following character classes: a. Lowercasecharacters b. Uppercasecharacters c. Numbers d. Punctuation e. Special characters (e.g., !@#$%^&*()_+= etc.) 2. Theminimumlengthofthepasswordshouldbe12charactersormore. Weakpasswordscontainthefollowingcharacteristics 1. Less than twelve (12) characters 2. Commonwordsfoundinthedictionary 3. Commonusagewordsinclude: a. Namesoffamily,pets,friends,co-workers,etc. b. Birthdays and other personal information 167

COMPUTERBESTPRACTICES UseAntivirusSoftware Antivirus software is a software utility that detects, prevents, and removes viruses, worms, and other malicious software from the computer. Antivirus programs are essential utilities for any computer. We strongly recommendusingoneofthefollowingAntivirusapplications: 1. Symantec 2. McAfee 3. Webroot 4. Bitdefender 5. Kaspersky 6. TrendMicro 7. WindowsDefender(ComeswithWindowsOSsystem) PerformRegularSoftwareandOperatingSystemUpdates Software and Operating System updates are critical to keeping your system running healthy. Update reminders can be annoying, especially if you have many applications; however, they can improve your experience eventually and ensure that you get the most from your technology. Before downloading newly released software or Operating System updates, we recommend reading other users’ reviews to ensure it’s safe to download and install. Be aware. Cybercriminals like to distribute phony applications designed to steal your information. RunComputerMaintenance Whileusingyourcomputer,temporaryinternetfiles,downloadedfiles,andcachefilesbuildupandreducehard drive space using software utilities such as the built-in Disk Cleanup for Windows or third-party applications such as CCleaner, which can locate and clear these files on your computer. Moreover, visiting many websites collects files that can slow your web browser. It also helps to check your browser’s preferences or settings to find its option to clear the cache or temporary internet files. BackupFiles Regular file backups prevent data loss and can even provide a copy of your entire system in case of hardware failure or malicious software. You can use an external hard drive or flash drive to save your backups and then usetheutility to quickly restore individual files or return your computer to a previous state. You can also utilize cloud storage solutions such as OneDrive, Google Drive, Dropbox, or another cloud storage service for more flexible access to your data on any device. KeepYourKeyboardCrumbFree Dip a cloth or towelette into the isopropyl alcohol and brush it along the tops of all the keys and surfaces. Scrub heavily used areas (such as the Enter key and space bar) to remove buildup. Use a dry, lint-free cloth to remove dust and polish the keyboard. AvoidExtremeTemperatures Computers get warm after a while, and some can get hot. The temperature changes are routine and part of cooling the laptop. However, be aware that if your computer gets hot, it could be an overheating sign, which canpotentially cause damage. Do not leave your computer in a hot car or direct sunlight. UseAProtectiveCase Whencarryingalaptopormovingyourcomputer,useaprotectivecaseorbagtoprotectitfromdamage. 168

COMPUTERSUPPORT New students at Gurnick Academy of Medical Arts participate in a mandatory new student computer orientation. During the orientation, instructions for setting up your computer are provided. Beyond that, the Gurnick AcademyofMedicalArtsSupportteammayofferthefollowinglevelofsupport: ● Softwareandcomputerconfiguration. ● Softwareandhardwaretroubleshooting. ● Providingloanermachinesduringtherepairprocess. YoucancontacttheGurnickAcademyofMedicalArtsITteambyemailingsupport@gurnick.edu. Whensending emails to support, describe your problem in detail, including your contact information, first and last name, and best contact number or email to reach you. Wedonotprovidesupportforhardwareandaccidentaldamageissues. SeeComputerWarranty COMPUTERWARRANTY Personal Devices ● Contactyourcomputermanufacturerforhardwareoraccidentaldamageissueswithyourdevice. ● Gurnick Academy of Medical Arts is not responsible for hardware, damages, or associated costs for repairing your device. DevicesPurchasedThroughGurnickAcademyofMedicalArts ● The Microsoft Factory warranty covers computers purchased through Gurnick Academy of Medical Arts from the date you use your equipment for one (1) year. ● ContacttheMicrosoftwarrantycenterforhardwareoraccidentaldamageissueswithyourdevice. ● Gurnick Academy of Medical Arts is not responsible for hardware, damages, or associated costs for repairing your device. USEOFAITOOLS The policies for AI usage are dynamic and will be constantly changing due to the rapid advancement of technology, information, and government regulations. As government regulations become implemented, the policy will be updated to reflect the current situation. Please check for regular updates to the addendum on Gurnick Academy’swebsite. Gurnick Academy of Medical Arts supports using AI tools for specific uses. AI tools can refine information, but the original idea and content must come from the user. This policy includes text, artwork, graphics, video, and audio. The Programs at Gurnick Academy of Medical Arts may allow different levels of AI use. Please refer to the student handbookforspecific guidelines regarding AI use for each program. Please note that the content generated by AI Tools may be inaccurate, provide fake citations, and image generation AI tools can occasionally provide highly offensive responses. Regardless of whether the content is generated by an AI tool or the user, the user is responsible for any offensive, inaccurate, biased, or unethical content submitted. AI tool users must be aware of the potential risks of submitting prompts, including confidential information, by law or Gurnick Academy of Medical Arts. The user is responsible for not violating any regulatory or intellectual 169

property laws, including submitting personal identifying information (PII). The use of AI tools must be properly documentedandcited. Students found to have used generative AI tools in unauthorized ways will result in consequences ranging from receiving a zero on the assignment to withdrawal from the program, as it would violate the academic dishonesty policy, such as cheating and plagiarism. Employees may be terminated from employment. Please ask theinstructor or supervisor for clarification if there are any questions or doubts about permitted usage. AcceptableUsesMayInclude(butarenotlimitedto): ● Brainstormingideas ● Draftinganoutline ● Fine-tuningyourresearch ● Requestinginformation ● Checkinggrammarandstyle NotAcceptableUsesMayInclude(butnotlimitedto): ● Impersonatingyouintheclassroom,suchascomposingandpostingdiscussionboardpostsorposting content in a group chat (i.e., Zoom or Google Hangout) ● Writingadraftofawritingassignment. ● Writingentireparagraphsorpaperstocompleteanassignment Please refer to the student or employee handbook for more details about using AI tools. Citation The use of AI tools must be documented for transparency. Citations should be in MLA or APA style, depending ontheassignment.Acitationforeachpromptmustbeincludedifmorethanonepromptwasused. APAStyle:https://apastyle.apa.org/blog/how-to-cite-chatgpt MLAStyle:https://style.mla.org/citing-generative-ai/ PROGRAMINFORMATION Program schedules vary per campus. The times and dates below are for general information. Please review yourprogrammaticschedulesintheAddendum,StudentHandbook,andEnrollmentAgreement. The Marking Period within each program refers to a designated period for each program, such as a module or semester. Table 28. Marking Period Table Marking Program NumberofMarkingPeriods Period A.S. in NM 8 A.S. in RT 8 DA Module VN 4 XTMAS 170

MA 3 A.O.S. in UT 8 A.O.S. in CUT A.O.S. in VUT Quarter 6 A.S. in MRI A.S. in PTA 4 B.S. in RT 9 BSN 8 BSN(LVNtoBSNPathway) 4 BSN(RNtoBSNPathway) 3 ADN Semester 6 MSN(BSNtoMSNPathway) ADN(LVNtoRNPathway) 2 A.S. in VN 2 B.S. in DMI 3 A.O.S. in RC 5 A.O.S. in RT Weeks 94 ASSOCIATE OF OCCUPATIONAL SCIENCE IN CARDIAC ULTRASOUND TECHNOLOGY PROGRAM(A.O.S.inCUT) 72WEEKS 1792CLOCKHOURS 107QUARTERCREDITHOURS ASSOCIATEOFOCCUPATIONALSCIENCEDEGREEPROGRAM, 6MODULES STANDARDOCCUPATIONALCLASSIFICATION(SOCCode): 29-2032.00 POTENTIALOCCUPATIONS: Please see a school official for the complete list of potential occupations. LOCATIONS:SacramentoandSanJose DELIVERY:Blended Gurnick AcademyofMedicalArtsstudentsintheUltrasoundLabattheSanJosecampus. A.O.S. in CUT Program Mission Gurnick Academy of Medical Arts’ mission is to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. A.O.S. in CUT Program Description 171

The Cardiac Ultrasound Technology program’s minimum expectations are to prepare competent entry-level Cardiac Sonographers in the cognitive (knowledge), psychomotor (skills), and affective (behavior) learning domains.Graduatesmayworkinhospitals,imagingcenters,physicians’offices,orclinics. A.O.S. in CUT Program Goals and Objectives ● TrainstudentstobeprofessionalandcompetentCardiacsonographersinthemedicalimaging communitybydevelopingtheirvisual,oral,andwritten communicationandcriticalthinkingskills. ● Developinterpersonalskillsincommunicatingandinteractingwithpatientsofallgenerations,cultures, andmedicalconditions. ● Developinterpersonalskillsincommunicatingandinteractingwithmedicalandadministrative personnel in the medical imaging setting so they will be effective team players. ● Teachstudentsknowledgeandunderstandingofhumanphysiology,pathology,andpathophysiology. ● Teachstudentsknowledgeandunderstandingofultrasoundphysicalprinciplesandinstrumentation. ● Teachstudentstheknowledge ofsonographicbiologicaleffectsandproperapplicationofsonographic instrumentation relative to imaging and image quality. ● Teachstudentsknowledgeandunderstandingofhumangrossandsectionalanatomyrelativetonormal andabnormalsonographicimaging. ● Teachstudentshowtoproducequalitydiagnosticimagesoftheheartwiththerequiredinformation contributing to the diagnostic process. ● Teachstudentsthenecessaryskillsforproperpatient carewhileutilizingethical, professional, and HIPAAguidelines. ● Providestudentswiththeknowledge,clinicalskills,problem-solvingabilities, and interpersonal skills to practice in the profession of sonography. ● Emphasizetheimportance andneedofbecomingcredentialedintheprofessionofCardiac Sonographer. ● PreparestudentstopasstheARDMScertificationexam. ● TeachandemphasizetheappropriateergonomicscanningapplicationsfortheCardiacSonographer’s well-being. A.O.S. in CUT Program Outline Table 29. A.O.S. in CUT Program Course Outline Course Clock Quarter Title Number Hours Credit Hours GE002 Principles of Physics 45 4.5 GE021 Essentials of Anatomy and Physiology 66 6.5 GE112 AlgebraI 45 4.5 GE110 Critical Thinking 45 4.5 GE230 Written & Oral Communication 45 4.5 CS300 Introduction to Cardiology 1 72 7.0 CS300L Laboratory Introduction to Cardiology 1 72 3.5 CS301 Adult Echocardiography 1 72 7.0 CS301L Laboratory Adult Echocardiography 1 72 3.5 CS400 Introduction to Cardiology 2 72 7.0 CS400L Laboratory Introduction to Cardiology 2 72 3.5 172

CS401 Adult Echocardiography 2 72 7.0 CS401L Laboratory Adult Echocardiography 2 72 3.5 CS520A Registry Preparation Course: Anatomy and Physiology 8 0.5 CS520B Registry Preparation Course: Pathology 1 8 0.5 CS520C Registry Preparation Course: Pathology 2 8 0.5 CS520D Registry Preparation Course: Pathology 3 8 0.5 CS520E Registry Preparation Course: Measurement Techniques 8 0.5 andManeuvers CS520F Registry Preparation Course: Clinical Care and Safety, 8 0.5 Instrumentation, Optimization, and Contrast CSX01 Clinical 1 400 13.0 CSX02 Clinical 2 400 13.0 UT200 Ultrasound Physics and Instrumentation 62 6.0 UT201 Sectional Anatomy 48 4.5 UT301 Patient Care for Ultrasound Professional 12 1.0 TOTAL 1,792 107 GeneralEducationCoursesareidentifiedinItalics. A.O.S. in CUT Program Information, Length, and Schedule The program information, length, and schedule may change. Please read the accompanying Addendum for changes and updates, and check in with the Admission Advisor for details. Gurnick Academy of Medical Arts Cardiac Ultrasound Technology Program has a library and classrooms with audiovisual teaching aids, textbooks, journals, anatomical charts, models, and e-library resources. The scan laboratory is equipped with ultrasound machinesandothercardiologyequipment. The Cardiac Ultrasound Technology Program is an Associate of Occupational Science Degree program. The student will receive didactic, laboratory, and clinical education focused on Cardiac ultrasound, which will cover cardiac anatomy and physiology, 2D and M-Mode imaging, PW, CW, and color flow Doppler, cardiac pathology, and methods of interpretation, which will be combined with General Education courses. The instructor-to-student ratio is 1:25 during lectures, 1:10 in the laboratory, and 1:1 during externship. The program comprises six (6) modules of twelve (12) weeks each. During the program’s first module (12 weeks), students will take General Education courses up to 24 hours per week via online delivery. During the second module (12 weeks), students will continue to take General Education courses online up to twenty-four (24) hours per week for the first twelve (12) weeks. The next two (2) modules (Module 3 and 4) consist of on-campus didactic/lab sessions only, which include three (3) to five (5) days per week of up to eight (8) hours per day didactic and lab instruction. After completing four (4) modules, students are generally expected to start attending externships four (4) days a week. Registry Preparation Courses (RPC) are scheduled monthly on days to be announced on a separate schedule andinnoparticularorder. The student receives nine hundred eighty-four (992) didactic and laboratory instruction and eight hundred (800) hours of clinical education, allowing them to apply the lecture topics to practical use. The curriculum provides students with the technical, clinical, and interpersonal skills necessary to succeed in this field. In 173

addition, the program prepares students to take their RCDS examinations. An Associate of Occupational Science Degree in Cardiac Ultrasound Technology is awarded upon program completion. The normal completion time for this program is seventy-two (72) weeks, excluding any holiday and vacation times. Class times can and may be rescheduled on an alternate day of the week (i.e., Sunday through Saturday) to ensure program completion is on time and the required program hours are fulfilled. Voluntary and Prudent Use Statement for Ultrasound Technology Instructions in the ultrasound training laboratory are made possible by the participation of students, both as the person scanning and the person being scanned (subject). All the exercises are developed to ensure prudent and safe use of the equipment and the subject. Participation is voluntary. Election not to participate will not affect grades. However, alternate training will need to be arranged. ASSOCIATEOFOCCUPATIONALSCIENCEINRESPIRATORYCAREPROGRAM(A.O.S.INRC) 75WEEKS 1446CLOCKHOURS 64SEMESTERUNITS ASSOCIATEOFOCCUPATIONALSCIENCEDEGREEPROGRAM, 5SEMESTERS STANDARDOCCUPATIONALCLASSIFICATION(SOCCode): 29-1126.00 POTENTIALOCCUPATIONS: Please see a school official for the complete list of potential occupations. LOCATIONS:Modesto DELIVERY:Blended AstockphotofromCanva.com. A.O.S. in RC Program Mission The Associate of Occupational Science in Respiratory Care (A.O.S. in RC) at Gurnick Academy of Medical Arts aims to educate undergraduate respiratory care (RC) students to meet the healthcare needs of individuals, families, and communities. Our mission is to motivate and provide guidance to each student throughout the program and prepare them to be valuable members of the allied health system. We strive to instill a sense of pride in the profession of respiratory care that will carry forth to every patient they encounter. Theprogramemphasizestheknowledgeandskillsappropriateforexaminationsrequiredbythe Respiratory Care Board of California and other regulatory bodies, such as the National Board for Respiratory Care. Theextensiveclinical preparation is under the supervision of respiratory therapists. Instruction occurs on anonlineplatform,inthelaboratory,andinclinical settings. A.O.S. in RC Program Description This program prepares graduates to pursue entry-level employment or jobs in related fields. The goal of this program is to prepare graduates with demonstrated competence in the cognitive (knowledge), psychomotor (skills), and affective (behavior) learning domains of respiratory care practice as performed by registered respiratory therapists (RRTs). A.O.S. in RC Program Goals and Objectives ● Provide a high-quality educational experience to each student desiring to enter the respiratory care profession. 174

● Provide a depth of human understanding and a wide range of respiratory-related skills based on scientific principles and established fundamentals in the industry. ● Guide the A.O.S. in RC student in collaborative practice with other healthcare professionals to meet patient needs. ● Help develop and empower the A.O.S. in RC students to become role models, patient advocates, patient educators, and caregivers who provide an environment conducive to maintaining dignity and maximizingthewellnessofeachindividual. ● Guide the student to actively participate in the learning process and assist with developing self-awareness and self-direction. ● Provide a shared learning environment between faculty and students through exchanging knowledgeandexperiencetopromotechangewithintheparticipants. ● Provide students with the training and skill sets necessary to treat patients across the age spectrum throughdidactic, laboratory, and experience via clinical practicum. A.O.S. in RC Program Outline Table 30. A.O.S. in RC Program Course Outline Course Title Clock Semester Number Hours Credit Hours GE112 AlgebraI 45 3.0 GE201 Introduction to Sociology 45 3.0 GE230 Written & Oral Communication 45 3.0 RC100 Respiratory Care Fundamentals I 15 1.0 RC120 MedicalTerminologyw/EmphasisinRespiratory 30 2.0 Care RC200 Respiratory Care Fundamentals II 75 4.0 RC220 AnatomyandPhysiologyw/Emphasisonthe 60 4.0 CardiopulmonarySystem RC240 Pharmacology 45 3.0 RC260 Patient Assessment and Application 60 3.0 RC300 Respiratory Care Fundamentals III 75 4.0 RC320 Introduction to Mechanical Ventilation 75 4.0 RC330 Clinical Practicum I 144 3.0 RC340 Specialized Respiratory Care 30 2.0 RC400 Respiratory Care Fundamentals IV 60 4.0 RC420 AdvancedMechanicalVentilation 75 4.0 RC430 Clinical Practicum II 216 4.5 RC500 NBRCReviewandTestPreparation 45 3.0 RC520 NeonatalandPediatricRespiratoryCare 90 5.0 RC530 Clinical Practicum III 216 4.5 TOTAL 1,446 64 175

GeneralEducationCoursesareidentifiedwith(GE) A.O.S. in RC Program Information, Length, and Schedule The program information, length, and schedule may change. Please read the accompanying Addendum for changes and updates, and check in with the Admission Advisor for details. Gurnick Academy of Medical Arts Respiratory Care Program has lab/classrooms equipped with audiovisual teaching aids, textbooks, journals, anatomical charts, models, and e-library resources. The laboratory is equipped with high-fidelity mannequins and equipment pertinent to the field of respiratory care, such as ventilators, nebulizers, intubation equipment, etc. The Respiratory Care Program is an Associate of Occupational Science Degree program. The student will receive didactic, laboratory, and clinical education on respiratory care. The Instructor-to-Student ratio is 1:25 during lectures, 1:10 in the laboratory, and 1:1 during externship. The program consists of five (5) semesters of fifteen (15) weeks each. During the program’s first semester (15 weeks), students will take General Education courses and core courses for up to 12 hours per week via online delivery. During the second Semester (15 weeks), students will only be taking core classes from here on out. Students can expect to spend 16 hours a week in the educational setting, not including outside work. Semester three will include online didactic, on-campus lab sessions, and the first clinical practice. Clinical Practice during this semester will occur during the first six (6) weeks in which the student is expected to participate in clinicals for two (2) twelve (12) hour shifts totaling twenty-four (24) hours a week. Semester four will include online didactic, on-campus lab sessions, and the second clinical practice. Clinical Practice during this semester will occur during the last nine (9) weeks in which the student is expected to participate in clinicals for two (2) twelve (12) hour shifts totaling twenty-four (24) hours a week. Semester five will include online didactic, on-campus lab sessions, and the second clinical practice. Clinical Practice during this semester will occur during the last nine (9) weeks in which the student is expected to participate in clinicals for two (2) twelve (12) hour shifts totaling twenty-four (24) hours a week. The student receives five hundred and seventy-six (576) hours in the clinical setting and eight hundred and seventy (870) hours of didactic and laboratory instruction. The curriculum provides students with the technical, clinical, and interpersonal skills necessary to succeed in this field. In addition, the program prepares students to take their NBRC examinations described in the Student Handbook. Upon completing the program, an Associate of Occupational Science Degree in Respiratory Care is awarded. The normal completion time for this program is seventy-five (75) weeks, excluding any holiday and vacation times. Class times can and may be rescheduled on an alternate day of the week (i.e., Sunday through Saturday) to ensure program completion is on time and the required program hours are fulfilled. Voluntary and Prudent Use Statement for Respiratory Care Instructions in the laboratory are made possible by the participation of students, both as the person performing assessments and the person being assessed (subject) when High-Fidelity Mannequins are not prudent. All the exercises are developed to ensure prudent and safe use of the equipment and the subject. Participation is voluntary. Election not to participate will not affect grades. However, alternate training will need to be arranged. 176

ASSOCIATEOFOCCUPATIONALSCIENCEINRADIOLOGICTECHNOLOGYPROGRAM(A.O.S. INRT) 94WEEKS 2,923CLOCKHOURS 157.5QUARTERCREDITHOURS ASSOCIATEOFOCCUPATIONALSCIENCEDEGREEPROGRAM STANDARDOCCUPATIONCLASSIFICATION (SOCCODE):29-2034.00,29-2035.00,29-2099.06 POTENTIALOCCUPATIONS: Please see a school official for the complete list of potential occupations. LOCATIONS:VanNuys DELIVERY:Blended(ResidentialandDistanceEducation) AGurnickAcademyofMedicalArtsinstructorwithstudentsintheImagingSkillsLabattheVanNuyscampus. A.O.S. in RT Program Mission The Associate of Occupational Science in Radiologic Technology program’s mission is to prepare students for employmentascertifiedradiologictechnologists. The program emphasizes the knowledge, skills, and entry-level competencies appropriate for examinations required by the California Department of Public Health, Radiologic Health Branch, and the American Registry of Radiologic Technologists® (ARRT®). A.O.S. in RT Program Description The Associate of Occupational Science Radiologic Technology program at Gurnick Academy of Medical Arts is committed to developing students’ intellectual, analytical, and critical thinking skills. Instructional methods based on established principles and practices of adult learning theory combined with classroom techniques encouragestudentparticipation. Duties for program graduates may include diagnostic imaging procedures in hospital diagnostic imaging departments, surgical theaters, emergency rooms, doctor’s offices, and other health care settings using fixed or portable machines. A felony conviction may affect a graduate’s ability to sit for certification examinations or attain state licensure. The student must understand the certification requirements and state or national board licensing exams. Such stipulations may change during the program. Students are responsible for inquiring with the appropriate agencies about current requirements before enrolling in the program if a student’s circumstances change when applying for certification or licensure. Clinical sites may themselves require a criminal background check or a medical examination. Students learn about the requirements for employment and certification, state board, or national board licensing exams. No student automatically receives a certificate in any way upon program completion. Students with felony convictions may not be eligible for certification. This program prepares graduates to pursue entry-level employment in the field or related fields. These specific job titles may not correspond directly with the program title. Although Gurnick Academy of Medical Arts will assist students with job placement, finding a job is their responsibility. Gurnick Academy of Medical Arts does not guarantee student placement in any of the described 177

occupations or at all. Some clinical rotations and radiographic examinations are deemed “gender-specific,” such as mammography and the hysterosalpingogram (HSG). While mammography is generally performed on females, the HSG is an examinationexclusively conducted on female patients. Male students should understand that they may not observe or perform these examinations because of their sensitivity. Didactic information on these examinations will be provided to all students. However, clinical experience in these examinations may be limited to only female students. A.O.S. in RT Program Goals and Objectives ● Students/graduateswilldemonstrateclinicalcompetency. ● Students/graduateswilldevelopproblem-solvingandcritical-thinking skills. ● Students/graduateswillapplyeffectivecommunicationskills. A.O.S. in RT Student Learning Outcomes ● Studentswilluseproperpositioningskills. ● Studentswillobtainradiographsofacceptablediagnosticquality. ● Studentswillexerciseproperradiationprotection. ● Students will be able to modify standard procedures to accommodate non-routine patient conditions. ● Studentswillbeabletocritiqueimagesfordiagnosticquality. ● Studentswilldemonstrateeffectiveoralandwrittencommunicationskills. A.O.S. in RT Program Outline Table 31. A.O.S. in RT Program Outline COURSE CLOCK QUARTERCREDIT COURSETITLE NUMBER HOURS HOURS GE011 Anatomy&PhysiologyI 56.0 5.5 GE112 AlgebraI 45.0 4.5 GE201 Introduction to Sociology 45.0 4.5 GE222 English Reading and Composition 45.0 4.5 GEH020 MedicalTerminology 18.0 1.5 GEH253 Ethics and Law in Radiography 24.0 2.0 Patient Care in Radiographic Imaging 45.0 4.0 XRT101 Radiographic Procedures I 70.0 6.0 XRT102 Radiographic Equipment and Exposure 50.0 5.0 XRT103 Radiographic Procedures II 70.0 6.0 XRT104 Radiation Protection and Physics 70.0 7.0 XRT105 Integration of Theory and Practice Fundamentals 25.0 2.0 XRT106 Clinical Practice I 160.0 5.0 XRT107 Clinical Practice II 160.0 5.0 XRT108 Clinical Practice III 160.0 5.0 XRT109 178

Clinical Practice IV 120.0 4.0 XRT110 ImagingProceduresandTechnicalFactors 30.0 3.0 XRT201 Radiographic Procedures III 80.0 7.0 XRT202 Radiographic Procedures IV 45.0 4.0 XRT203 Radiographic Procedures V 50.0 4.5 XRT204 Digital Imaging Technologies 45.0 4.5 XRT205 Clinical Practice V 160.0 5.0 XRT206 Clinical Practice VI 160.0 5.0 XRT207 Clinical Practice VII 160.0 5.0 XRT208 Clinical Practice VIII 160.0 5.0 XRT209 Clinical Practice IX 160.0 5.0 XRT210 Clinical Practice X 160.0 5.0 XRT211 Cross-Sectional Anatomy 30.0 3.0 XRT212 Clinical Practice XI 160.0 5.0 XRT213 Clinical Practice XII 160.0 5.0 XRT214 XRT215C ComputedTomography 40.0 4.0 or or XRT215M Mammography Radiologic Technology Seminar I 80.0 8.0 XRT216 Radiologic Technology Seminar II 80.0 8.0 XRT217 TOTAL 2,923.0 157.5 GeneralEducationcoursesareidentifiedinItalics. Applicants who possess a current State of California Limited Permit (License) in Chest, Extremities, and Torso Skeletal will receive credit granting for the following courses. Table 32. A.O.S. in RT Program Credit Granting for Applicants with Current License COURSE CLOCK QUARTERCREDIT COURSETITLE NUMBER HOURS HOURS GE011 Anatomy&PhysiologyI 56.0 5.5 GEH020 MedicalTerminology 18.0 1.5 GEH253 Ethics and Law in Radiography 24.0 2.0 Patient Care in Radiographic Imaging 45.0 4.0 XRT101 Radiographic Procedures I 70.0 6.0 XRT102 Radiographic Equipment and Exposure 50.0 5.0 XRT103 Radiographic Procedures II 70.0 6.0 XRT104 Radiation Protection and Physics 70.0 7.0 XRT105 179

Integration of Theory and Practice 25.0 2.0 XRT106 Fundamentals Clinical Practice I 160.0 5.0 XRT107 Clinical Practice II 160.0 5.0 XRT108 Clinical Practice III 160.0 5.0 XRT109 Clinical Practice IV 120.0 4.0 XRT110 TOTAL 1,028.0 58.0 A.O.S. in RT Program Information, Length, and Schedule The program information, length, and schedule may change. Read the accompanying Addendum for changes andupdates,andconnectwithanAdmissionAdvisorformoredetails. The A.O.S. in Radiologic Technology program provides a library and classrooms with modern media teaching aids, textbooks, journals, periodicals, anatomical charts, phantoms, and energized lab equipment. The Associate of Occupational Science in Radiologic Technology program consists of 157.5 quarter credit hours completed over 94weeksfordayandnightstudents,for2,923contacthours.Beforegraduation,studentsmust complete1,880hoursofclinicalpractice. ASSOCIATE OF OCCUPATIONAL SCIENCE IN ULTRASOUND TECHNOLOGY PROGRAM (A.O.S. in UT) 96WEEKS 2386CLOCKHOURS 139.5QUARTERCREDITHOURS ASSOCIATEOFOCCUPATIONALSCIENCEDEGREE PROGRAM,8MODULES STANDARDOCCUPATIONALCLASSIFICATION(SOCCode): 29-2032.00 POTENTIALOCCUPATIONS: Please see a school official for the complete list of potential occupations. LOCATIONS:Fresno,Sacramento,andSanJose DELIVERY:Blended(ResidentialandDistanceEducation) AGurnickAcademyofMedicalArtsinstructorandstudentintheUltrasoundSkillsLabattheFresnocampus. A.O.S. in UT Program Mission Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. A.O.S. in UT Program Description The A.O.S. in Ultrasound Technology program’s minimum expectations are to prepare competent entry-level sonographers in the cognitive (knowledge), psychomotor (skills), and affective (behavior) learning domains. Graduatesmayworkinhospitals,imagingcenters,physicians’offices,orclinics. A.O.S. in UT Program Goals and Objectives Diagnostic Medical Sonography (DMS) requires providing diagnostic sonographic images and possessing critical 180

thinking skills. The Sonographer needs to make crucial judgments while performing sonographic exams. Sonographers are professionals who must possess high-level skills in diagnostic sonographic techniques under theguidanceofalicensedphysician. A sonographer is responsible for providing excellent patient care and gathering adequate data for diagnoses. Programgraduateswillbeabletoperform,ataminimum,thefollowingobjectives. Cognitive ● Obtain,review,andintegratepertinentpatientdataforoptimumdiagnosticresults. ● Demonstrate critical thinking skills during sonographic procedures to provide optimum diagnostic services. Psychomotor ● Perform sonographic procedures appropriately and accurately, recording all anatomic and physiologic information for interpretation by a physician. ● Document and present complete and accurate sonographicfindingstotheinterpretingphysicianto facilitate patient diagnosis. ● Maintainoptimalfunctionofthesonographicequipment. ● Assistphysiciansduringinvasiveultrasound-guidedprocedures. Affective ● Employeffectivecommunicationskillswithpatientsandallhealthcareteammembers. ● Providecompassionatepatientcareandeducationtopromoteoverallwell-being. ● Actprofessionallywithinrecognizedethicalandlegalstandards. ● Demonstrateacommitmenttolifelonglearning. Students who demonstrated and completed all clinical and academic competencies required may take the AmericanRegistryofDiagnosticMedicalSonography(ARDMS)certificationexamsinthearea(s)ofstudy. A.O.S. in UT Program Outline Table 33. A.O.S. in UT Program Course Outline Quarter CourseNumber Title Clock Hours Credit Hours GE002 Principles of Physics 45.0 4.5 GE021 Essentials of Anatomy and Physiology 66.0 6.5 GE112 AlgebraI 45.0 4.5 GE110 Critical Thinking 45.0 4.5 GE230 Written & Oral Communication 45.0 4.5 UT201 Sectional Anatomy 48.0 4.5 UT200 Ultrasound Physics and Instrumentation 62.0 6.0 UT301 Patient Care for Ultrasound Professional 12.0 1.0 UT302 AbdominalSonography1 84.0 8.0 UT302L Laboratory AbdominalSonography1 84.0 4.0 UT303 Small Parts Sonography 1 28.0 2.5 UT303L Laboratory Small Parts Sonography 1 28.0 1.0 181

UT304 Small Parts Sonography 2 12.0 1.0 UT304L Laboratory Small Parts Sonography 2 12.0 0.5 UT402 AbdominalSonography2 68.0 6.5 UT402L Laboratory AbdominalSonography2 68.0 3.0 UT405 NeonatalSonography 32.0 3.0 UT406 Pediatric Sonography 28.0 2.5 UT410 Integration of Theory and Practice Lab 1 16.0 0.5 UT504A Vascular Sonography 1 28.0 2.5 UT504AL Laboratory Vascular Sonography 1 28.0 1.0 UT504B Vascular Sonography 2 28.0 2.5 UT504BL Laboratory Vascular Sonography 2 28.0 1.0 UT504C Vascular Sonography 3 28.0 2.5 UT504CL Laboratory Vascular Sonography 3 28.0 1.0 UT504D Vascular Sonography 4 24.0 2.0 UT504DL Laboratory Vascular Sonography 4 24.0 1.0 UT505 MSK 20.0 2.0 UT505L Laboratory MSK 20.0 1.0 UT607A Gynecology1 24.0 2.0 UT607B Gynecology2 28.0 2.5 UT607L Laboratory Gynecology Sonography 52.0 2.5 UT609A Obstetric Sonography 1 32.0 3.0 UT609B Obstetric Sonography 2 62.0 6.0 UT610 Integration of Theory and Practice Lab 2 88.0 4.0 UT620A MasterScanningLabExtracranialVascularDuplexExam 8.0 0.5 UT701 Clinical 3 288.0 9.5 UT720B MasterScanningLabLowerExtremityVenousExam 8.0 0.5 UT720C MasterScanningLabLowerExtremityArterialExam 8.0 0.5 UT720D MasterScanningLabUpperExtremityVenousExam 8.0 0.5 UT801 Clinical 4 288.0 9.5 MasterScanningLabDuplexEvaluationofthePortal UT820E 8.0 0.5 VenousSystemforPortalHypertension MasterScanningLabLowerExtremityVenousValve UT820F 8.0 0.5 Insufficiency Duplex Exam MasterScanningLabUpperExtremityMappingfor UT820G 8.0 0.5 Dialysis Access UTX01 Clinical 1 192.0 6.0 UTX02 Clinical 2 192.0 6.0 182

TOTAL 2,386.0 139.5 GeneralEducationCoursesareidentifiedinItalics. A.O.S. in UT Program Information, Length, and Schedule The program information, length, and schedule may change. Please read the accompanying Addendum for changesandupdates. Connect with an admission advisor for more details. The A.O.S. in Ultrasound Technology program has a library and classrooms with audiovisual teaching aids, textbooks, journals, anatomical charts, models, and e-library resources. The scan laboratory has ultrasound machines and an Ankle-Brachial Index (ABI) machine. The Ultrasound Technology Program is an Associate of Occupational Science Degree program. The student will receive didactic and clinical education in abdominal sonography, small parts, obstetrics and gynecology, ultrasound physics and instrumentation, musculoskeletal (MSK), pediatric, neonatal, patient care, and vascular sonography. This training will be combined with General Education courses. The instructor-to-student ratio is 1:30 in residential lectures, 1:25 in online lectures, 1:10 in the laboratory, and 1:1 during clinical rotation. The program consists of eight (8) 12-week modules. During the program’s first module, students will take General Education courses up to 24 hours per week via online delivery during the first program module. Students will continue taking General Education courses online for up to 24 hours per week for the first seven (7) weeks of the second program module. The workload consists of on-campus didactic/lab sessions, including up to six (6) hours per day of instruction for up to three (3) days per week during the last five (5) weeks of the secondmodule. The subsequent two (2) modules(ModulesIIIandIVorModulesVandVI,dependingonthemodulesequence) consist of on-campus didactic/lab sessions only, including three (3) days per week of up to eight (8) hours per day of didactic instruction. After completing four (4) modules, students are generally expected to participate in clinical rotations two (2) days per week, up to eight (8) hours per day. Students will continue to attend didactic/lab sessions on-campus three (3) days per week, up to eight (8) hours per day. In the last two (2) modules, students attend clinical rotations only for three to four (3 – 4) days per weekandattendMasterScanningLabcoursesonceamonthondaystobeannouncedonaseparateschedule. The student receives 1,426 didactic and laboratory instruction hours and 960 clinical education hours, allowing them to apply the lecture topics to practical use. The curriculum provides students with the technical, clinical, and interpersonal skills necessary to succeed in this field. Furthermore, the program prepares students to take their ARDMSexaminations. An Associate of Science Degree in Ultrasound Technology is awarded upon program completion. The expected completion time for this program is 96 weeks, excluding holidays and vacation times. Class times can and may be rescheduled on an alternate day of the week (Sunday through Saturday) to ensure on-time program completionandfulfillment of required program hours. MasterScanningLabs(MSL)maybescheduledatothercampusesasneededandinnoparticularorder. Voluntary and Prudent Use Statement for Ultrasound Technology Instructions in the ultrasound training laboratory are made possible by the participation of students, both as the person scanning and the person being scanned (subject). All the exercises are developed to ensure prudent and safe use of the equipment and the subject. Participation is voluntary. Election not to participate will not affect grades. However, alternate training will need to be arranged. 183

ASSOCIATEOFOCCUPATIONALSCIENCEINVASCULARULTRASOUNDTECHNOLOGY PROGRAM(A.O.S.inVUT) 72WEEKS 1784CLOCKHOURS 105QUARTERCREDITHOURS ASSOCIATEOFOCCUPATIONALSCIENCEDEGREEPROGRAM, 6MODULES STANDARDOCCUPATIONALCLASSIFICATION(SOCCode): 29-2032.00 POTENTIALOCCUPATIONS: Pleaseseeaschoolofficialforthe completelist of potential occupations. LOCATIONS: SanJose DELIVERY:Blended Gurnick AcademyofMedicalArtsstudentsintheUltrasoundSkillsLabattheSanJose campus. A.O.S. in VUT Program Mission Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. A.O.S. in VUT Program Description The A.O.S. in Vascular Ultrasound Technology program’s minimum expectations are to prepare competent entry-level Vascular sonographers in the cognitive (knowledge), psychomotor (skills), and affective (behavior) learning domains. Graduates may work in hospitals, imaging centers, physicians’ offices, or clinics. A.O.S. in VUT Program Goals and Objectives ● Trainstudentstobeprofessionalandcompetentvascularsonographersinthemedicalimaging communitybydevelopingtheirvisual,oral,andwritten communicationandcriticalthinkingskills. ● Developinterpersonalskillsincommunicatingandinteractingwithpatientsofallgenerations,cultures, andmedicalconditions. ● Developinterpersonalskillsincommunicatingandinteractingwithmedicalandadministrative personnel in the medical imaging setting so they will be effective team players. ● Teachstudentsabouthumanphysiology,pathology,andpathophysiology. ● Teachstudentsknowledgeandunderstandingofultrasoundphysicalprinciplesandinstrumentation. ● Teachstudentstheknowledge ofsonographicbiologicaleffectsandproperapplicationofsonographic instrumentation relative to imaging and image quality. ● Teachstudentsknowledgeandunderstandingofhumangrossandsectionalanatomyrelativetonormal andabnormalsonographicimaging. ● Teachstudentshowtoproducequalitydiagnosticimagesoftheheartwiththerequiredinformation contributing to the diagnostic process. ● Teachstudentsthenecessaryskillsforproperpatient carewhileutilizingethical, professional, and HIPAAguidelines. ● Providestudentswiththeknowledge,clinicalskills,problem-solvingabilities, and interpersonal skills to practice in the sonography profession. ● Emphasizetheimportance andneedofbecomingcredentialedintheprofessionofVascular Sonographer. ● PreparestudentstopasstheCCI(RVS)orARDMS(RVT)certificationexam. 184

● TeachandemphasizetheappropriateergonomicscanningapplicationsfortheVascularSonographer’s well-being. A.O.S. in VUT Program Outline Table 34. A.O.S. in VUT Program Course Outline Course Clock Quarter Title Number Hours Credit Hours GE002 Principles of Physics 45.0 4.5 GE021 Essentials of Anatomy and Physiology 66.0 6.5 GE112 AlgebraI 45.0 4.5 GE110 Critical Thinking 45.0 4.5 GE230 Written & Oral Communication 45.0 4.5 UT200 Ultrasound Physics and Instrumentation 62.0 6.0 UT201 Sectional Anatomy 48.0 4.5 UT301 Patient Care for Ultrasound Professional 12.0 1.0 UT620A MasterScanningLabExtracranialVascularDuplexExam 8.0 0.5 UT720B MasterScanningLabLowerExtremityVenousExam 8.0 0.5 UT720C MasterScanningLabLowerExtremityArterialExam 8.0 0.5 UT720D MasterScanningLabUpperExtremityVenousExam 8.0 0.5 UT820E MasterScanningLabDuplexEvaluationofthePortal 8.0 0.5 VenousSystemforPortalHypertension UT820F MasterScanningLabLowerExtremityVenousValve 8.0 0.5 Insufficiency Duplex Exam UT820G MasterScanningLabUpperExtremityMappingfor 8.0 0.5 Dialysis Access VU300 Cerebrovascular Sonography 60.0 6.0 VU300L Cerebrovascular Sonography Lab 60.0 3.0 VU301 AbdominalVascularSonography 84.0 8.0 VU301L AbdominalVascularSonographyLab 84.0 4.0 VU400 LowerExtremityVenousSystem 36.0 3.5 VU400L LowerExtremityVenousSystemLab 36.0 1.5 VU401 LowerExtremityArterial System 36.0 3.5 VU401L LowerExtremityArterial System Lab 36.0 1.5 VU 402 UpperExtremityVenousSystem 36.0 3.5 VU402L UpperExtremityVenousSystemLab 36.0 1.5 VU403 UpperExtremityArterial System 28.0 2.5 185

VU403L UpperExtremityArterial System Lab 28.0 1.0 VUX01 Clinical 1 400.0 13.0 VUX02 Clinical 2 400.0 13.0 TOTAL 1,784.0 105.0 GeneralEducationCoursesareidentifiedinItalics. A.O.S. in VUT Program Information, Length, and Schedule Theprograminformation,length,andschedulemaychange.ReadtheaccompanyingAddendumforchanges andupdates,andcheckinwiththeAdmissionAdvisorfordetails.TheA.O.S.inVascularUltrasoundTechnology programhasalibraryandclassroomswithaudiovisualteachingaids,textbooks,journals,anatomicalcharts, models,ande-libraryresources. The scan laboratory is equipped with ultrasound machines and other cardiology equipment. TheA.O.S.inVascularUltrasoundTechnologyprogramisanAssociateofOccupationalScienceDegreeprogram. Thestudentwillreceivedidactic, laboratory, and clinical education on vascular ultrasound covering vascular anatomyandphysiology,2Dimaging,PW,colorflowDoppler,andvascularpathology.Methodsof interpretation will be combined with General Education courses. The Instructor-to-Student ratio is 1:25 during lectures, 1:10 in the laboratory, and 1:1 during the externship. Theprogramcomprisessix(6)modulesoftwelve(12)weekseach.Duringtheprogram’sfirstmodule(12 weeks), students will take General Education courses up to 24 hours per week via online delivery. During the secondmodule(12weeks),studentswillcontinuetotakeGeneralEducationcoursesonlineuptotwenty-four (24) hours per week for the first twelve (12) weeks. Thenexttwo(2)modules(Modules3and4)consistofdidactic/labsessionsonly,whichincludethree(3)tofive (5) days per week of up to eight (8) hours per day of didactic and lab instruction. After completing four (4) modules,studentsaregenerallyexpectedtostartattendingexternshipsfour(4)orfive(5)daysaweek. MasterScanningLabs(MSL)arescheduledmonthlyondaystobeannouncedonaseparatescheduleandinno particular order. Thestudentreceivesninehundredeighty-four(984)didacticandlaboratoryinstructionandeighthundred (800) hours of clinical education, allowing them to apply the lecture topics to practical use. The curriculum provides students with the technical, clinical, and interpersonal skills necessary to succeed in this field. In addition, the program prepares students to take their RVS/RVT examinations. AnAssociateofOccupationalScienceDegreeinVascularUltrasoundTechnologyisawardeduponprogram completion. The normal completion time for this program is seventy-two (72) weeks, excluding any holiday and vacation times. Class times can and may be rescheduled on an alternate day of the week (i.e., Sunday through Saturday) to ensure program completion is on time and the required program hours are fulfilled. Voluntary and Prudent Use Statement for Ultrasound Technology Instructions in the ultrasound training laboratory are made possible by the participation of students, both as the person scanning and the person being scanned (subject). All the exercises are developed to ensure prudent and safe use of the equipment and the subject. Participation is voluntary. Election not to participate will not affect grades. However, alternate training will need to be arranged. 186

ASSOCIATEOFSCIENCEINMAGNETICRESONANCEIMAGINGPROGRAM(A.S.inMRI) 72WEEKS 1,886CLOCKHOURS 115QUARTERCREDITHOURS ASSOCIATEOFSCIENCEDEGREEPROGRAM,6 MODULES STANDARDOCCUPATIONALCLASSIFICATION (SOCCode):29-2035.00. POTENTIAL OCCUPATIONS: Please see a school official for the complete list of potential occupations. LOCATIONS:Modesto,Sacramento,andSanJose DELIVERY:Blended,FullDistanceEducation Stock photo from Canva.com. A.S. in MRI Program Mission Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. A.S. in MRI Program Description Magnetic Resonance Imaging (MRI) Technologists are valued members of today’s healthcare team. They used specialized MRI equipment to create images of structures inside the human body, among other vital tasks. While supervised by board-certified radiologists, MRI Technologists have responsibility and independence in performingtheir duties. MRI program graduates acquire preparation to perform clinical MRI examinations, focusing on image production, quality control, signal-to-noise ratio, and primary pulse sequences. Read more about the benefits of becoming an MRI Technologist. The program includes online classwork, required online lectures, and clinical experiences correlating with theoretical education. Gurnick Academy of Medical Arts considers clinical experience essential in healthcare education. Accordingly, students are rotated throughout our affiliated medicalfacilities while attending our MRI Technologist school. A.S. in MRI Program Goals ● Train students who demonstrate the knowledge and skills required for employment as entry-level MRItechnologists. ● Develop interpersonal skills in communicating with patients and medical and administrative individuals. ● Helpstudentsacquiretheskillsneededtopracticeproperpatientcare. ● Instill students with the knowledge, clinical skills, problem-solving abilities, and interpersonal skills to practice in magnetic resonance imaging. ● Equip graduates to be competent in entry-level positions as MRI Technologists and display appropriate behaviors, as set forth by the American Registry of Radiologic Technologists® (ARRT®) andtheSectionforMagneticResonanceTechnologists(SMRT). ● PreparestudentstotakeandpasstheARRT®(MR)Examination. A.S. in MRI Program Outline 187

Table 35. ASMRI Program Course Outline Course QuarterCredit Title Clock Hours Number Hours GE001 Biology Basics 45.0 4.5 GE021 Essentials of Anatomy and Physiology 66.0 6.5 GE110 Critical Thinking 45.0 4.5 GE112 AlgebraI 45.0 4.5 GE201 Introduction to Sociology 45.0 4.5 MR001 Introduction to MRI 120.0 12.0 MR101 Sectional Anatomy I 24.0 2.0 MR102 MedicalTerminologyI 18.0 1.5 MR103 Physical Principles of MRI 54.0 5.0 MR104 Patient Care 36.0 3.5 MR111 MRIClinical I 264.0 8.5 MR201 Sectional Anatomy II 24.0 2.0 MR202 MedicalTerminologyII 18.0 1.5 MR203 MRIProtocolsandProceduresI 42.0 4.0 MR204 MRISafety 36.0 3.5 MR211 MRIClinical II 252.0 8.0 MR301 Sectional Anatomy III 24.0 2.0 MR302 Physics I 31.0 3.0 MR303 MRIProtocolsandProceduresII 42.0 4.0 MR304 MRIPathologyinDiagnosticImaging 36.0 3.5 MR311 MRIClinical III 252.0 8.0 MR401 Medicolegal Considerations in Healthcare 24.0 2.0 MR402 MRIRegistryReview 36.0 3.5 MR403 Physics II 31.0 3.0 MR404 ComputersinImagingandPACS 24.0 2.0 MR411 MRIClinical IV 252.0 8.0 TOTAL 1,886.0 115.0 GeneralEducationCoursesareidentifiedinItalics. Table 36. US and Nevada Constitution Course QuarterCredit Title Clock Hours Number Hours SNO001 USandNevadaConstitution* 0.0 0.0 *This satisfies the Nevada Constitution requirement NRS 394.150 and is only required for students who reside in Nevada. A.S. in MRI Program Information, Length, and Schedule The Associate of Science in MRI program provides a library. The Instructor-to-Student ratio is 1:20 during 188

lectures and 1:1 or 1:2 during clinical experiences. The MRI program comprises seventy-two (72) weeks of full-time study. The program is offered twice per calendar year. The curriculum encompasses all magnetic resonance imaging technology principles, including 246 hours of general education instruction, 620 hours of technical didactic instruction, and 1,020 hours of supervised clinical experience. The program is based on the parameters suggested by the Joint Review Commission on Education in Radiologic Technology (JRCERT), the Association of Educators in Radiologic Sciences (AERS), and the American Society of Radiologic Technologists (ASRT). In addition, the MRI program integrates general education components to complementtechnicalcourses. The program consists of six (6) 12-week modules. Students will take General Education courses up to 24 hours per week during the first two (2) program modules. Students will take Technical courses online for five (5) weeksduringthesecondprogrammodule. Clinical Rotations start in module 3. Students will attend their clinical rotation at an assigned MRI facility for a period of forty-eight (48) weeks, two to four (2 – 4) days per week, with a minimum of 21 hours per week with +/- ten (10) hours per week variance. Occasional Saturday/Sunday clinical hours will be required to complete clinical hours. The expected program completion time is seventy-two (72) weeks, excluding holidays and vacation times. The curriculum provides our students with the general education, technical, clinical, and interpersonal skills necessary to succeed in this challenging field. An Associate of Science Degree is awarded upon program completion. Class times can and may be rescheduled on an alternate day of the week (Sunday through Saturday) to ensure on-time program completion and the fulfillment of required program hours. ASSOCIATEOFSCIENCEINNUCLEARMEDICINETECHNOLOGYPROGRAM(A.S.inNM) 94WEEKS 2646CLOCKHOURS 173QUARTERCREDITHOURS ASSOCIATEOFSCIENCEDEGREEPROGRAM,8MODULES STANDARDOCCUPATIONALCLASSIFICATION (SOCCode):29-2033.00 POTENTIALOCCUPATION: Please see a school official for the complete list of potential occupations. LOCATIONS:Concord DELIVERY:Blended,FullDistanceEducation Stock photo from Canva.com. A.S. in NM ProgramMission Gurnick AcademyofMedicalArtsaimstoofferqualityalliedhealthandnursingprogramsthatintegrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. TheNuclearMedicineTechnologyprogram’smissionistoprovidethehealthcarecommunitywith compassionate,competent,andprofessionalnuclearmedicinetechnologists. 189

Theprogram’sphilosophyistoeducatestudentstosucceedintheevolvingfieldofNuclearMedicine.Our students will demonstrate the highest standards of excellence, integrity, didactic commitment, and clinical competency.Studentswillgraduatewithadiversebackgroundofclinicalexposureandexemplify compassionateandprofessionalpatientcare. A.S. in NM ProgramDescription TheAssociateofScienceinNuclearMedicineTechnology(ASNM)isa24-monthprogrampreparingstudents with essential general education classes, a core nuclear medicine curriculum, and real-life experience at clinical sites. The program begins with basic nuclear medicine principles and builds on that knowledge to bring the student to the level needed to pass the national credentialing exam. Thecurriculumincludesdiagnosticandtherapeuticnuclearmedicineprocedures,radiopharmaceutical preparation and administration, and quality control procedures for imaging equipment. The program also includes courses on emerging hybrid imaging technologies, including positron emission tomography (PET), computedtomography(CT),andmagneticresonanceimaging(MRI).Theprogramincludesonlineclasswork, live online lectures, and clinical experiences. In their clinical experiences, students will be under the direct supervision of a nuclear medicine technologist andlearntheadministrationandpreparationofradiopharmaceuticalsforuseindiagnosticandtherapeutic applications. They also use specialized imaging equipment to visualize the human body’s pathologic conditions andphysiologic processes. Thestudentelevatestheircritical thinking skills to deliver high-quality care consistently. Student externships mayoccurinhospitals,outpatientclinics, imaging centers, research facilities, and mobile imaging trailers. A.S. in NM ProgramGoalsandObjectives ● Graduatestudentswilldemonstratetheknowledgeandskillsrequiredofcompetententry-level nuclear medicine technologists. ● Empowerstudentstoapplycriticalthinkingandproblem-solvingskillsintheclinicalsettingto ensurepatientsafety and diagnostic study acquisition. ● Producestudentswhowilldemonstrateeffectivecommunicationskillswithpatientsandmedical andadministrative staff. ● Promoteacknowledgmentofandadherencetoethicalandprofessionalresponsibilities. ● Cultivatestudentswhowillupholdradiationprotectionpracticestoprotectthemselvesandtheir patients. ● Preparestudentstotakeandpassthenationalcredentialingexamination. A.S. in NM ProgramOutline Table 37. ASNMProgramCourseOutline Course Clock Quarter Title Number Hours Credit Hours GE002 Principles of Physics 45.0 4.5 GE003 ConceptualChemistrywithLaboratory 75.0 6.0 190

GE020A HumanBodyinHealth&DiseaseIwithLaboratory 75.0 6.0 GE020B HumanBodyinHealth&DiseaseIIwithLaboratory 75.0 6.0 GE112 AlgebraI 45.0 4.5 GE230 Written & Oral Communication 45.0 4.5 GEH301 Ethics & Law in Health Sciences 45.0 4.5 NM111 Patient Care in Nuclear Medicine 100.0 8.0 NM112 Introduction to the Science of Nuclear Medicine 100.0 10.0 NM121 Radiation Protection & Biology 75.0 7.5 NM122 Instrumentation in Nuclear Medicine I 80.0 8.0 NM123 Nuclear Physics 60.0 6.0 NM131 Nuclear Procedures I 95.0 8.5 NM132 Instrumentation in Nuclear Medicine II 75.0 7.5 NM141 Nuclear Procedures II 60.0 6.0 NM142 Nuclear Pharmacy 60.0 6.0 NM143 Principles of CT in Nuclear Medicine 70.0 7.0 NM250C Clinical Practice I 128.0 4.0 NM251 Cross-Sectional Anatomy 48.0 4.5 NM252 Principles of PET in Nuclear Medicine 60.0 6.0 NM253 Pharmacology,DrugAdministration,andVenipuncture 54.0 4.5 NM260C Clinical Practice II 360.0 12.0 NM270C Clinical Practice III 384.0 12.5 NM271 Nuclear Procedures III 36.0 3.5 NM280C Clinical Practice IV 360.0 12.0 NM281 Nuclear Medicine Capstone 36.0 3.5 TOTAL 2,646.0 173.0 GeneralEducationcoursesareidentifiedinItalics. A.S. in NM ProgramInformation,Length,andSchedule Theprograminformation,length,andschedulemaychange.ReadtheaccompanyingAddendumforchanges andupdates,andconnectwithanAdmissionAdvisorfordetails. TheNuclearMedicineTechnologyprogramisanAssociateofSciencedegreeprogram.Thestudentwillreceive didactic, laboratory, and clinical experience in affiliated medical facilities. The Instructor-to-Student ratio is 1:25 during online lectures and 1:1 during clinical externships. Classes may be scheduled Monday through Sunday. 191

Students will attend up to forty (40) hours per week of instruction, including didactic, labs, and clinical. Clinical activities may be held during weekdays or weekends, and shifts may include day or evening as the clinical site requires. Didactic courses are held between 8:00 AM to 8:00 PM. Students receive 1,414 hours of didactic and laboratory instruction and 1,232 hours of clinical education, allowing them to apply the lecture topics to practical use. ASSOCIATEOFSCIENCEINNURSINGPROGRAM(ADN) 90WEEKS(GENERIC);33WEEKS(LVNTORN) 80SEMESTERCREDITHOURS ASSOCIATEDEGREEPROGRAM,6SEMESTERS LVNTORN,2SEMESTERS STANDARDOCCUPATIONALCLASSIFICATION (SOCCode):29-1141.00,29-1141.01 POTENTIALOCCUPATIONS: Please see a school official for the complete list of potential occupations. LOCATION:Fresno DELIVERY: Blended (Residential and Distance Education) AGurnickAcademyofMedicalArtsstudentintheNursingSkillsLabattheFresnocampus. ADNProgramMission Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. ADNProgramDescription Nursing graduates play an essential role in healthcare. Registered Nurses are vital to the healthcare team as they provide and coordinate patient care. RNs assess patients, administer medication and treatments, consult doctors, and teach patients how to manage illness or injuries. Weoffer two (2) different pathways that include didactic and hands-on training. The first track is a six-semester programfornon-nursingapplicants. Weoffer asecondtrackforthosewithanLVN/LPNlicenseandcompletedgeneraleducationcourses.LVNtoRN applicants can complete the program in two semesters and a three-week LVN to RN transition course. After program completion, students will receive an NCLEX prep class to prepare for the RN licensure board examination. ADNProgramGoals ● Provide a high-quality educational experience to each individual desirous to advance in the healthcare profession. ● Provide adepthofhumanunderstandingandawiderangeofnursingskillsbasedoncommunication andscientific principles. ● Guide the Associate Degree student in collaborative practice with other healthcare professionals to meetpatientnursingneeds. ● Employthenursingprocessintheprovisionofsafeandeffectivecare. 192

● Help develop the Associate degree student to become a role model, patient advocate, patient educator, and caregiver who provides an environment conducive to maintaining dignity and maximizingthewellnessofeachindividual. ● Guide the Associate Degree student to actively participate in the learning process and assist with developing self-awareness and self-direction. ● Provide a shared learning environment between faculty and students by exchanging knowledge and experience to promote change within the participants. ● Prepare the Associate Degree student with the knowledge, skill, and ability to administer safe, ethical, competent nursing care as a beginning practitioner in various settings. ADNEducationalObjectives Upon completion of the Associate of Science in Nursing Program, the graduate will function within the roles of theRegisteredNurseinvarioushealthcaresettingsandbeableto: 1. Demonstrate the cognitive abilities necessary to integrate nursing concepts and the multidisciplinary body of knowledge to provide therapeutic nursing care. 2. Exhibit the psychomotor and psychotherapeutic abilities necessary for safe nursing care. 3. Implementteachingstrategiestopromoteadaptationtohealth. 4. Demonstratecaringbehaviorsintheprovisionofpatient-centered,individualized care. 5. Usecritical thinking and the nursing process for clinical decision-making. 6. Careforclients and families from diverse and multicultural populations across the lifespan. 7. Communicateeffectivelywithclients, families, and interdisciplinary healthcare team members. 8. Provide a standard of care consistent with legal, ethical, and regulatory guidelines and the BRN Practice Act. 9. Recognize responsibility for maintaining competence as a registered nurse through self-evaluation andcontinuingnursingeducation. 10. Perform as an accountable member of the nursing profession. 11. Understand and integrate technology into providing care to clients across the healthcare continuum. 12. Develop a foundation for advanced study and professional growth in nursing. ADNProgramOutline Table 38. Generic ADN Program Outline ABHES BRN Semester Course CourseTitle Clock Clock Credit Number Hours Hours Hours GE020A HumanBodyinHealthandDiseaseIwithLab 75.0 90.0 4.0 GE041 GeneralMicrobiologywithLab 75.0 90.0 4.0 GE222 English Reading and Composition 45.0 45.0 3.0 GE112 AlgebraI 45.0 45.0 3.0 GE202 GeneralPsychology 45.0 45.0 3.0 GE020B HumanBodyinHealthandDiseaseIIwithLab 75.0 90.0 4.0 GE031 Nutrition in Health & Disease 45.0 45.0 3.0 GE110 Critical Thinking 45.0 45.0 3.0 GE201 Introduction to Sociology 45.0 45.0 3.0 GE240 Public Speaking, Basics of Effective Communication 45.0 45.0 3.0 RN100 FundamentalsofNursingTheory* 45.0 45.0 3.0 RN101 FundamentalsofNursingClinicalandLab* 157.5 157.5 3.5 RN102 Health AssessmentTheory* 30.0 30.0 2.0 RN103 Health AssessmentSkills Lab* 67.5 67.5 1.5 193

RN104 FundamentalsofPharmacology 30.0 30.0 2.0 RN106 Pathophysiology 30.0 30.0 2.0 RN200 Medical/Surgical I Theory-Introduction to Med/Surg* 45.0 45.0 3.0 RN201 Medical/Surgical I Clinical-Introduction to Med/Surg* 90.0 90.0 2.0 RN202 Medical/Surgical II Theory-Intermediate Med/Surg* 45.0 45.0 3.0 RN203 Medical/Surgical II Clinical-Intermediate Med/Surg* 90.0 90.0 2.0 RN300 MaternalNewbornTheory* 45.0 45.0 3.0 RN301 MaternalNewbornClinical* 67.5 67.5 1.5 RN302 CareofChildrenTheory* 45.0 45.0 3.0 RN303 CareofChildrenClinical* 67.5 67.5 1.5 RN304 Medical/Surgical III Theory-Advanced Med/Surg* 45.0 45.0 3.0 RN305 Medical/Surgical III Clinical-Advanced Med/Surg* 90.0 90.0 2.0 RN400 MentalHealthTheory* 30.0 30.0 2.0 RN401 MentalHealthClinical* 90.0 90.0 2.0 RN402 Medical/Surgical IV Theory-Complex/Critical Care 45.0 45.0 3.0 Med/Surg&Leadership* RN403 Medical/Surgical IV Clinical-Complex/Critical Care 90.0 90.0 2.0 Med/Surg&Leadership* TOTAL 1,785.0 1,830.0 80.0 GeneralEducationCoursesareidentifiedinItalics. *Paired course. See the course description for more details. ADNProgram–LVNtoRNAdvancedPlacementProgramOutline Prerequisite-General Education Courses LVN to RN Advanced Placement (Can be completed at Gurnick Academy of Medical Arts or be credit granted). Table 39. LVN to RN Advanced Placement General Education Outline ABHES BRN Semester Course CourseTitle Clock Clock Credit Number Hours Hours Hours GE020A HumanBodyinHealthandDiseaseIwithLab 75.0 90.0 4.0 GE041 GeneralMicrobiologywithLab 75.0 90.0 4.0 GE222 English Reading and Composition 45.0 45.0 3.0 GE112 AlgebraI 45.0 45.0 3.0 GE202 GeneralPsychology 45.0 45.0 3.0 GE020B HumanBodyinHealthandDiseaseIIwithLab 75.0 90.0 4.0 GE031 Nutrition in Health & Disease 45.0 45.0 3.0 3.0 GE110 Critical Thinking 45.0 45.0 3.0 GE201 Introduction to Sociology 45.0 45.0 3.0 GE240 Public Speaking, Basics of Effective Communication 45.0 45.0 TOTAL 540.0 585.0 33.0 GeneralEducationCoursesareidentifiedinItalics. Prerequisite Nursing Courses: LVN to RN Advanced Placement (These courses will be credit granted for LVNs, subject to the Credit Granting Policy). 194

Table 40. LVN to RN Advanced Placement Prerequisite Outline Semester Course CourseTitle Clock Hours Credit Number Hours RN100 FundamentalsofNursingTheory* 45.0 3.0 RN101 FundamentalsofNursingClinicalandLab* 157.5 3.5 RN102 Health AssessmentTheory* 30.0 2.0 RN103 Health AssessmentSkills Lab* 67.5 1.5 RN104 FundamentalsofPharmacology 30.0 2.0 RN200 Medical/Surgical I Theory-Introduction to Med/Surg* 45.0 3.0 RN201 Medical/Surgical I Clinical-Introduction to Med/Surg* 90.0 2.0 RN202 Medical/Surgical II Theory-Intermediate Med/Surg* 45.0 3.0 RN203 Medical/Surgical II Clinical-Intermediate Med/Surg* 90.0 2.0 TOTALNURSINGPREREQUISITECOURSES 600.0 22.0 *Paired course. See the course descriptions for more details. Table 41. LVN to RN Advanced Placement Admission Course Outline Semester Course CourseTitle Clock Hours Credit Number Hours RN180 Nursing Transition Advanced Placement Theory & Lab 120.0 5.0 Course TOTALGURNICKACADEMYADMISSIONCOURSES 120.0 5.0 Table 42. LVN to RN Advanced Placement Professional Course Outline Semester Course CourseTitle Clock Hours Credit Number Hours RN106 Pathophysiology 30.0 2.0 RN300 MaternalNewbornTheory* 45.0 3.0 RN301 67.5 MaternalNewbornClinical* 1.5 RN302 45.0 CareofChildrenTheory* 3.0 RN303 CareofChildrenClinical* 67.5 1.5 RN304 Medical/Surgical III Theory-Advanced Med/Surg* 45.0 3.0 RN305 Medical/Surgical III Clinical-Advanced Med/Surg* 90.0 2.0 RN400 MentalHealthTheory* 30.0 2.0 RN401 MentalHealthClinical* 90.0 2.0 Medical/Surgical IV Theory-Complex/Critical Care RN402 45.0 3.0 Med/Surg&Leadership* Medical/Surgical IV Clinical-Complex/Critical Care RN403 90.0 2.0 Med/Surg&Leadership* 195

TOTALGURNICKACADEMYPROFESSIONALCOURSES 645.0 25.0 TOTALPROGRAMFORDEGREE(PrerequisitesplusProfessional) 1,785.0 80.0 *Paired course. See the course descriptions for more details. ADNProgramInformation,Length,andSchedule The ADN is a degree program providing a library and classrooms with audiovisual teaching aids, textbooks, journals, anatomical charts, and models. The Instructor-to-Student ratio is 1:12 in the laboratory and clinical, 1:28 in residential lectures, and 1:25 in online lectures. The ADN program is designed with two (2) separate admission pathways. The pathways are intended for full-time attendance. Generic ADN(6semestersfor80SemesterCreditHours) In the program’s first two (2) semesters, students will take 33 Semester-Credit Hours of General Education courses via online delivery. The third semester is 15 weeks and comprises 14 Semester Credit Hours (nine (9) lecture and five (5) clinical and skills lab hours). Courses include Fundamentals of Nursing, encompassing theory, skills and clinical, Health Assessment, Pharmacology, and Pathophysiology. Theory and Lab will be held Monday through Friday. The clinical schedule may vary depending on clinical site availability. The fourth semester comprises ten (10) Semester Credit Hours (six (6) lecture and four (4) clinical hours). Courses include Introduction to Med/Surg I Theory and Clinical and Intermediate Med/Surg Theory and Clinical. Classes will be held Monday through Friday. The clinical schedule may vary depending on clinical site availability. The fifth semester consists of 14 Semester Credit Hours (nine (9) lecture and five (5) clinical hours). Courses include Maternal/Newborn Theory and Clinical, Care of Children Theory and Clinical, and Advanced Med/Surg I Theory and Clinical. Theory and Lab will be held Monday through Friday. The clinical schedule may vary dependingonclinicalsite availability. The sixth semester comprises nine (9) Semester Credit Hours (five (5) lecture and four (4) clinical hours). Courses include Mental Health Nursing Theory and Clinical and Complex Med-Surg Theory and Clinical/Leadership. Classes will be held Monday through Friday. The clinical schedule may vary depending on clinical site availability. Students enrolled in this pathway receive 885 hours of didactic and 900 hours of clinical and lab instruction, allowing them to apply the lecture topics to practical use. LVNtoRNAdvancedPlacement(2semestersforatotalof25SemesterCreditHours): Students in this pathway can complete the ADN program within 33 weeks (two (2) semesters and a three (3) weekLVNtoRNtransitioncourse),assumingmaximumcreditgrantingfornursingandGEcourses. AnadmissioncourseisrequiredforallstudentselectingtoenrollintheLVNtoRNAdvancedPlacement program.TheadmissioncourseisRN180–NursingTransitionAdvancedPlacementTheory&LabCourse.Itisa 5-unit, 120-hour course that evaluates the student’s readiness to enroll in the Advanced Placement pathway. Thestudentmustdemonstratetherequiredknowledgeandskillstocompletethiscourse.Allstudentsmust completethesebeforestartinganyProfessionalCourses. 196

Thethirdsemesteris16SemesterCreditHours(11lectureandfive(5)clinicalhours).Classeswillbeheld MondaythroughFridaywithtwo(2)daysoncampus(9hoursofclasseachweekfor15weeks)andnine(9) hours/two(2)daysperweekinclinicalpracticeforten(10)weeks. Thefourthsemesterisnine(9)SemesterCreditHours(five(5)lectureandfour(4)clinicalhours).Classeswillbe held MondaythroughFridaywithtwo(2)daysoncampus(7hoursofclass)andthree(3)daysperweekin clinical practice, each for eight to nine (8 – 9) hours. Students receive 292.5 hours of didactic and 472.5 hours of clinical and lab instruction from this pathway, allowing them to apply the lecture topics to practical use. The curriculum provides students with the technical, clinical, and interpersonal skills necessary to succeed in this challenging field. The expected program completiontimeis33weeks,excludingholidaysandvacationtimes. Gurnick AcademyofMedicalArtshasadoptedATIstandardizedtestingtoassessstudentlearningoutcomesand evaluate student readiness for the nursing licensure examination. The NCLEX Preparation and Remediation course assists students in this program by focusing directly on the current NCLEX-RN test plan, application process, and test-taking strategies to prepare for the NCLEX-RN licensure exam. Preparation for NCLEX-RN is provided to the students. Students are permitted two (2) attempts to pass the ATI exit exam to graduate. The first attempt is given after program completion. The second attempt is given two (2) weeksafterprogramcompletion.Underextraordinarycircumstances,applicablestudentsmaybeeligiblefora third attempt. See the Student Grievance and Appeals Policy for more information. LVN30-UnitOption This option is available to all individuals who are Licensed Vocational Nurses in California. Completing the required courses will provide the opportunity and eligibility to take the California Registered Nurse licensure examination. This option does not meet the Associate of Arts Degree in Nursing graduate requirements, and students will not graduate from the nursing degree program. In addition, several states do not recognize individuals who complete this option or pass the NCLEX-RN examination as registered nurses. AdmissiontotheLVN30UnitOptionisdependentonspaceavailability.Thecandidatemustmeetthecriteriato enroll in the 30 Unit Option. 22.5 units must be completed in the Gurnick Academy of Medical Arts Associate Degree Nursing program. The remaining eight (8) units will be transfer credits of four (4) units from any stand-alone Physiology with lab that includes all body systems equivalent to the GE 020A & GE 020B or Human Body in Health & Disease I w/Lab and Human Body in Health & Disease II w/Lab and four (4) units of Microbiology with Lab which are admission requirements for this option. This option does not apply to ADN students enrolled in the program or to students who failed any course from the ADN program. The RN 180 Nursing Advanced Placement Transition course is not required but is recommended for completion as an elective course. Table 43. LVN 30-Unit Option Course SemesterCredit CourseTitle Clock Hours Number Hours Nursing Transition Advanced Placement Theory & RN180 120.0 5.0 LabCourse Table 44. LVN 30-Unit Option Course Outline Course SemesterCredit CourseTitle Clock Hours Number Hours RN102 Health AssessmentTheory 30.0 2.0 197

RN103 Health AssessmentSkills Lab 67.5 1.5 RN304 Medical/Surgical III Theory-Advanced Med/Surg 45.0 3.0 RN305 Medical/Surgical III Clinical-Advanced Med/Surg 90.0 2.0 RN400 30.0 MentalHealthTheory 2.0 RN401 90.0 MentalHealthClinical 2.0 Medical/Surgical IV Theory-Complex/Critical Care RN402 45.0 3.0 Med/Surg&Leadership Medical/Surgical IV Clinical-Complex/Critical Care RN403 90.0 2.0 Med/Surg&Leadership TOTALGURNICKACADEMYPROFESSIONALCOURSES 607.5 17.5 TOTALPROGRAMFOR30-UnitOption(TransferplusProfessional) — 25.5 ASSOCIATEOFSCIENCEINPHYSICALTHERAPISTASSISTANTPROGRAM(A.S.inPTA) 80 WEEKS, including prerequisites taken before enrolling in the 44 weeks of technical courses 1353CLOCKHOURS 101QUARTERCREDITHOURS ASSOCIATEOFSCIENCEDEGREEPROGRAM,4 QUARTERS STANDARDOCCUPATIONALCLASSIFICATION (SOCCode):31-2021.0. POTENTIAL OCCUPATIONS: Please see a school official for the complete list of potential occupations. LOCATION:SanJose DELIVERY: Blended (Residential and Distance Education) Gurnick AcademyofMedicalArtsstudentsinthePhysicalTherapistAssistantclassroomattheSanJosecampus. A.S. in PTA Program Mission The A.S. in Physical Therapist Assistant program aims to support the mission of Gurnick Academy of Medical Arts and is based upon the program’s philosophy. The A.S. in Physical Therapist Assistant program will prepare andgraduatestudentstomeetourdiversecommunity’sgrowingneeds. The A.S. in Physical Therapist Assistant program strives to provide students with the necessary skills to enter the workforce as competent, thinking, respectful, and compassionate individuals. They will provide legal and ethical care within the standards of practice for Physical Therapist Assistants under a physical therapist’s supervision. A.S. in PTA Program Description A.S. in Physical Therapist Assistant program graduates join an in-demand career in the growing healthcare field. Physical Therapist Assistants provide physical therapy services under the supervision of a licensed physical therapist, which is within the scope of practice for PTAs. They provide patients with instructions for therapeutic exercise and utilize therapeutic modalities that incorporate massage, stretching, selected manual therapy interventions, and electrotherapies. The program includes classwork, laboratory training, and clinical experiences correlating with theoretical education. The technical courses incorporate the minimum skills of Physical Therapist Assistant graduates at the 198

entry-level and the Standards of Ethical Conduct for the Physical Therapist Assistant developed by the American Physical Therapy Association (APTA). Gurnick Academy of Medical Arts considers clinical experience essential for healthcare education. Accordingly, students are rotated throughout our affiliated clinical facilities while completing the Physical Therapist Assistant program. PTAsmustcompleteatwo(2)yearassociatedegreeandarelicensed,certified,orregisteredinmoststates.* *Source: American Physical Therapy Association. Graduation from an accredited physical therapist assistant program allows the graduate to be eligible to take the National Physical Therapy Exam (NPTE) for PTAs and the California Law Exam (CLE). After successfully passing these exams, the student will be licensed to practice in California. Please see the Accreditation, Approval, Recognition, Membership section for information about Gurnick Academy of Medical Arts’ PTA programaccreditation. ThePhysical Therapist Assistant Program is an Associate of Science Degree program. A.S. in PTA Program Goals ● The program will offer a sequential, integrated technical curriculum that reflects contemporary Physical Therapist Assistant practice. ● The program will prepare graduates to provide physical therapy interventions in various settings within the PTA scope of practice and under a physical therapist’s supervision. ● The program will prepare graduates to demonstrate ethical and professional behaviors consistent with California State Law and Practice Acts and the professional standards of practice. ● The program will employ faculty who demonstrate current knowledge in their teaching areas and are committedtoprofessionalstandardsofexcellence. ● The program will prepare graduates to utilize self-assessment and awareness in communication, skills, knowledge, and behaviors with patients/clients, caregivers, colleagues, and other healthcare teammembers. A.S. in PTA Philosophy ● Physical Therapists and Physical Therapist Assistants are valued members of today’s healthcare team. ● Physical Therapists and Physical Therapist Assistants must understand their respective roles and respect them best to meet the patient’s/client’s needs. ● Students will benefit from a curriculum that supports multiple learning styles, is varied in educational experiences, and is structured to provide interaction between faculty and students. ● Students will benefit from a curriculum that recognizes, fosters understanding, and embraces diversity. ● Students will benefit from a curriculum reacting to Physical Therapy knowledge and technology changes. ● Tobesuccessful asaPhysicalTherapistAssistantandmeettheprofession’sneeds,thestudentmust understandlearningasalifelongactivity. ● Clinical experience in various settings is vital for the student to acquire entry-level skills as a Physical Therapist Assistant. ● Physical Therapist Assistant students are adult learners. Gurnick Academy of Medical Arts expects themtotakeresponsibilityforlearning, professional behavior, respect for others, and preparedness. ● FacultymembersarepositiverolemodelsintheprofessionofPhysicalTherapy. ● Gurnick Academy of Medical Arts does not discriminate against students based on race, color, 199

creed, national origin, gender, sexual orientation, age, disability, or marital status. A.S. in PTA Program Outline Table 45. A.S. in PTA General Education Courses Requiredprogramprerequisitecourses Equivalent (to transfer into Gurnick Academy of Medical Arts at the time of QuarterCredits Clock Hours enrollment) Humanities: 50.0 5.0 English: Reading and Writing Composition Humanities: 40.0 4.0 Oral Communication:SpeechorInterpersonalCommunication Sciences: AnatomyandPhysiologywithLab 140.0 12.0 Note:100lecturehourswith40laboratoryhours Mathematics: 50.0 5.0 MinimumAlgebra1 Social Science: 40.0 4.0 Introduction to Psychology or Lifespan Psychology Social Science Elective: History, Economics, Political Science, Geography, Sociology, 40.0 4.0 Anthropology, or General Psychology TOTALGENERALEDUCATIONCOURSES 360.0 34.0 Table 46. A.S. in PTA Technical Courses and Total Program Hours. Course Quarter Title Clock Hours Number Credit Hours PTA100 Introduction to Physical Therapist Assistant 22.0 2.0 PTA110 FundamentalPTAProcedureswithlab 77.0 4.5 PTA120 Clinical Kinesiology with lab 77.0 4.5 PTA130 Pathology 44.0 4.0 PTA210 ProceduresII with lab 66.0 4.0 PTA220 OrthopedicManagement 66.0 4.0 PTA230 Professional Behaviors 33.0 3.0 PTA222 Patient Care Skills I 22.0 1.0 PTA225 Clinical Education I 184.0 6.0 PTA226 Clinical Education I Seminar 11.0 1.0 PTA240 Applied Neurology 66.0 4.0 Physical Therapy Aspects of Growth, Development, PTA250 44.0 3.0 andAging PTA260 Selected Topics 44.0 3.0 PTA233 Patient Care Skills II 22.0 1.0 PTA235 Clinical Education II 240.0 8.0 PTA280 Senior Seminar 33.0 3.0 200

PTA245 Clinical Education III 280.0 9.0 PTA290 Licensure Exam Preparation 22.0 2.0 TOTALGURNICKACADEMYTECHNICALCOURSES 1,353.0 67.0 TOTALPROGRAMFORDEGREE:GEPLUSTECHNICAL 1,713.0 101.0 A.S. in PTA Program Information, Length, and Schedule The program information, length, and schedule may change. Read the accompanying Addendum for changes andupdates,andconnectwithanAdmissionAdvisorformoredetails. The Physical Therapist Assistant program is an Associate of Science degree program. The program follows the 1+1 model in which General Education Courses are completed before enrollment into the technical education curriculum at Gurnick Academy of Medical Arts. General education coursework, including Anatomy and Physiology, is transferred to Gurnick Academy of Medical Arts from the student’s previous college coursework. This allows the Gurnick Academy of Medical Arts programtobeofferedonlyin44weeksoftechnicalcoursework. Classes begin twice a year in January and July and are scheduled Monday through Friday full-time during the day. Clinical education assumes the Clinical Site hours during the day. The A.S. in Physical Therapist Assistant program at the San Jose campus enjoys a 1,776 sq. ft. classroom/laboratory equipped with industry-standard equipment at typical Physical Therapy facilities. This includes cardio, modalities, balance, weights, and treatment tables. The classroom lecture instructor-to-student ratio is 1:20, and in the laboratory sessions, the ratio is 1:15. Clinical education is a crucial part of the PTA Program. Students have the opportunity for three (3) full-time clinical rotations at various types of Physical Therapy facilities located locally and out of state. ASSOCIATEOFSCIENCEINRADIOLOGICTECHNOLOGYPROGRAM(A.S.INRT) 94WEEKS 2,974CLOCKHOURS 167QUARTERCREDITHOURS ASSOCIATEOFSCIENCEDEGREEPROGRAM,8MODULES STANDARDOCCUPATIONALCLASSIFICATION (SOCCode):29-2034.00,29-2035.00,29-2099.06 POTENTIALOCCUPATIONS:Pleaseseeaschoolofficialforthe completelist of potential occupations. LOCATIONS:ConcordandSacramento DELIVERY:Blended(ResidentialandDistanceEducation) Gurnick AcademyofMedicalArtsstudentsintheImagingSkillsLabattheSacramentocampus. A.S. in RT Program Mission TheA.S.inRadiologicTechnologyProgramfacultyisdedicatedtoprovidingqualifiedindividualswithanoptimal learning experience. We strive to provide the medical imaging community with competent radiologic technologists. They will demonstrate the highest standards of ethics, professionalism, clinical competency, and critical thinking while providing compassionate and respectful patient care. 201

TheprogramphilosophyensuresthatgraduatesperformradiologicproceduresasdefinedbytheAmerican Society of Radiologic Technologists Practice Standards. Graduates of the A.S. in Radiologic Technology program will possess professionalism and ethics consistent with the American Registry of Radiologic Technologists Principles of Professional Conduct for Radiologic Technologists and Code of Ethics. A.S. in RT Program Description ARadiologicTechnologist is trained in the “art and science” of creating images of the human body using ionizing radiation. The radiologic technologist works closely with the radiology doctor (radiologist) and other physicians and plays a vital role as a professional member of the medical team. Technologists work in hospitals (general radiography, surgery, trauma, pediatrics, clinics), doctors’ offices, and imagingcenters. The role of radiologic science in medicine is continually growing. New applications and imaging equipmentareinaconstantstateofdevelopment.Thecontinuedgrowthanddevelopmentofimagingdepend onhighlyqualified and well-trained radiologic technologists. Someclinical rotations and radiographic examinations are deemed “gender-specific,” such as mammography andthehysterosalpingogram(HSG).Whilemammographyisgenerallyperformedonfemales,theHSGisan examinationexclusively conducted on female patients. Malestudentsshouldunderstandthattheymaynotbeallowedtoobserveorperformtheseexaminations becauseoftheirsensitivity. Didactic information on these examinations will be provided to all students. However,clinical experience in these examinations may be limited to only female students. A.S. in RT Program Goals and Objectives ● Graduatestudentswiththeclinicalcompetencerequiredtobeanentry-leveltechnologist. ● Produce students who will demonstrate effective interpersonal skills with the entire healthcare teamandthepublic. ● Enable students to employ appropriate critical thinking and problem-solving skills to prepare to be entry-level technologists in the clinical setting. A.S. in RT Student Learning Outcomes ● Demonstratethepositioningskillsofanentry-leveltechnologist. ● Evaluateimagesfordiagnosticquality. ● Demonstrateeffectivecommunicationskillswiththehealthcareteam. ● Employcommunicationskillswiththepatientsandthepublic. ● Abilitytoadapttopatients’conditionsthatdeviatefromroutineexams. ● UtilizepropersafetyandALARApracticesforroutineandnon-routineexams. Students will establish a plan for professional development and career enhancement upon graduation. A.S. in RT Program Outline Table 47. A.S. in RT Program Course Outline QuarterCredit Number Title Clock Hours Hours GE011 Anatomy&PhysiologyI 56.0 5.5 GE110 Critical Thinking 45.0 4.5 GE112 AlgebraI 45.0 4.5 GE201 Introduction to Sociology 45.0 4.5 202

GE222 English Reading and Composition 45.0 4.5 GEH020 MedicalTerminology 18.0 1.5 RT110C Clinical Practice I 128.0 4.0 RT111 Radiologic Patient Care 42.0 4.0 RT112 Radiation Physics and Exposure 58.0 5.0 RT113 Radiographic Procedures I 48.0 4.5 RT113L Radiographic Procedures I Lab 30.0 1.5 RT120C Clinical Practice II 168.0 5.5 RT121 Radiation Protection and Biology 50.0 5.0 RT122 Digital Imaging 52.0 4.5 RT123 Radiographic Procedures II 48.0 4.5 RT123L Radiographic Procedures II Lab 30.0 1.5 RT130C Clinical Practice III 176.0 5.5 RT131 Radiographic Physics II and Fluoroscopy 48.0 4.5 RT132 Ethics and Law in Radiography 24.0 2.0 RT133 Radiographic Procedures III 45.0 4.5 RT133L Radiographic Procedures III Lab 33.0 1.5 RT140C Clinical Practice IV 192.0 6.0 RT142 Radiographic Pathology 48.0 4.5 RT143 Radiographic Procedures IV 45.0 4.5 RT143L Radiographic Procedures IV Lab 33.0 1.5 RT250C Clinical Practice V 280.0 9.0 RT251 Radiographic Pharmacology and Venipuncture 36.0 3.0 RT252 Cross Sectional Anatomy 40.0 4.0 RT260C Clinical Practice VI 240.0 8.0 RT261 AdvancedDigitalImaging 30.0 3.0 RT262 Radiographic AdvancedProcedures 48.0 4.5 RT270C Clinical Practice VII 264.0 8.5 RT271 Patient Care and Procedures Seminar 48.0 4.5 RT272 ComputedTomography or or 40.0 4.0 RT273 Mammography RT274 AdvancedRadiationProtection 50.0 4.0 RT280C Clinical Practice VIII 280.0 9.0 RT281 ImageProductionandSafetySeminar 48.0 4.5 RT282 Professional Development and Advancement 18.0 1.5 203

TOTAL 2,974.0 167.0 GeneralEducationCoursesareidentifiedinItalics. Applicants who possess a current State of California Limited Permit (License) in Chest, Extremities, and Torso Skeletal will receive credit granting for the following courses. Table 48. A.S. in RT Program Credit Granting for Applicants with Current License COURSE CLOCK QUARTERCREDIT COURSETITLE NUMBER HOURS HOURS GE011 Anatomy&PhysiologyI 56.0 5.5 GEH020 MedicalTerminology 18.0 1.5 RT111 Radiologic Patient Care 42.0 4.0 RT112 Radiation Physics and Exposure 58.0 5.0 RT113 Radiographic Procedures I 48.0 4.5 RT113L Radiographic Procedures I Lab 30.0 1.5 RT121 Radiation Protection and Biology 50.0 5.0 RT122 Digital Imaging 52.0 4.5 RT123 Radiographic Procedures II 48.0 4.5 RT123L Radiographic Procedures II Lab 30.0 1.5 RT110C Clinical Practice I 128.0 4.0 RT120C Clinical Practice II 168.0 5.5 TOTAL 728.0 47.0 A.S. in RT Program Information, Length, and Schedule Theprograminformation,length,andschedulemaychange.PleasereadtheaccompanyingAddendumfor changesandupdates.ConnectwithanAdmissionAdvisorfordetails. TheA.S.inRadiologicTechnologyprogramprovidesalibraryandclassroomswithmediateachingaids, textbooks, journals, periodicals, anatomical charts, phantoms, and energized lab equipment. TheRadiologicTechnologyprogramisanAssociateofSciencedegreeprogram.Thestudentwillreceive didactic, laboratory, and clinical experience in affiliated medical facilities. The Instructor-to-Student ratio is 1:30 during residential lectures, 1:25 during online lectures, 1:10 in the laboratory, and 1:1 during clinical externships. Classes may be scheduled MondaythroughSunday.Studentswillattendanaverageofforty(40)hoursper weekofinstruction, including didactic, labs, and clinical. Clinical activities may be held during weekdays or weekends,andshiftsmayincludeday,evening,orgraveyardastheclinicalsiterequires.Didacticcoursesare held between8:00AMto8:00PM. Theprogram’saffiliated clinical sites hold current state-issued certificates as approved clinical sites. The clinical sites provide supervised clinical instruction in the patient care setting. All clinical sites employ radiologic 204

technologists and supervisors/operators (doctors) who hold certification from the State of California Radiologic Health Branch. ASSOCIATEOFSCIENCEINVOCATIONALNURSINGPROGRAM(A.S.inVN) 82 WEEKS, including technical courses taken before enrolling in the 30 weeksofGeneralEducationcourses 2,070CLOCKHOURS 90.5 SEMESTERCREDITHOURS ASSOCIATEDEGREEPROGRAM LOCATION:Fresno DELIVERY:Blended(ResidentialandDistanceEducation) Gurnick AcademyofMedicalArtsstudentsintheSimulationLearningCenterattheFresnocampus. A.S. in VN Program Mission Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. A.S. in VN Program Description A.S. in Vocational Nursing program graduates join a career in the healthcare field. Vocational nurses provide primary medical care under the direction of registered nurses and doctors. They monitor patients’ health, discuss care with patients, keep records, and administer primary care, including changing bandages and inserting catheters. The Associate of Science in Vocational Nursing program is a two (2) semester program for graduates of an approvedVocationalNursingorPracticalNursingprogramwhowishtoobtainanAssociateofScienceDegree. The program builds on the vocational nursing diploma program by adding the same general education courses to our Associate of Science in Nursing Program (ADN). A.S. in VN Program Goals and Objectives ● Incorporate nursing, behavioral, and physical sciences principles to provide competent care to clients of different ages with different biopsychosocial needs. ● Apply knowledge of specific disease conditions in the prevention, treatment, nursing care, and rehabilitation of clients. ● Differentiate the role of the Vocational Nurse within the medical team. ● Adheretoprofessionalstandardsincorporatinglegalandethicalresponsibilities. ● Utilize critical thinking in assessing, planning, intervening, and evaluating client care within the scopeofVocationalNursepractice. ● Use effective communication to demonstrate organization, prioritization, delegation, and collaboration with healthcare professionals. ● Prepare the Associate Degree student with the knowledge, skill, and ability to administer safe, ethical, competent nursing care as a beginning practitioner in various settings. Table 49. A.S. in VN Program Course Outline COURSE CLOCK SEMESTER COURSETITLE NUMBER HOURS CREDITHOURS 205

GE020A HumanBodyinHealthandDiseaseIwithLab 75.0 4.0 GE041 GeneralMicrobiologywithLab 75.0 4.0 GE222 English Reading and Composition 45.0 3.0 GE112 AlgebraI 45.0 3.0 GE202 GeneralPsychology 45.0 3.0 GE020B HumanBodyinHealthandDiseaseIIwithLab 75.0 4.0 GE031 Nutrition in Health & Disease 45.0 3.0 GE110 Critical Thinking 45.0 3.0 GE201 Introduction to Sociology 45.0 3.0 GE240 Public Speaking, Basics of Effective 45.0 3.0 Communication TOTAL 540.0 33.0 General Education Courses are identified in Italics. A.S. in VN Program Information, Length, and Schedule The expected program length is 30 weeks to complete all 33 semester credit hours of online General Education courses after receiving transfer credit for 57.5 semester credits of a prior Vocational Nursing or Practical Nursing program.Graduatesearn90.5semestercredithoursandanAssociateofScienceDegreeinVocationalNursing. BACHELOROFSCIENCEINDIAGNOSTICMEDICALIMAGINGPROGRAM(B.S.inDMI) 45WEEKS 121SEMESTERCREDITHOURS DEGREEPROGRAMS,3SEMESTERS STANDARDOCCUPATIONALCLASSIFICATION(SOCCode): 29-2032.00, 29-2099.06, 29-2034.00, 29-2035.00 POTENTIALOCCUPATIONS: Please see a school official for the complete list of potential occupations. LOCATION:Concord DELIVERYFORMAT:Online Stock photo from canva.com. B.S. in DMI Program Mission To prepare imaging professionals with higher education, leadership skills, and opportunities for upward mobility in healthcare. B.S. in DMI Program Description The online Bachelor of Science in Diagnostic Medical Imaging (BSDMI) degree provides the certified imaging professional with the foundational skills necessary to advance. Enhancedmarketabilityisaninfluential motive for acquiring a bachelor’s degree in Diagnostic Medical Imaging. A bachelor’s degree makes advancing in radiology, business, IT, and public health possible. Positions in administration, management, and education generally require advanced degrees. The applicant can choose oneofsix(6)specialty tracks to further the imaging professional’s career. ● Imaging Informatics – Training in the Imaging Informatics courses will prepare the student for the PACS/RISadministratorrole. 206

● Leadership and Management – Training in the Leadership and Management courses will prepare thestudentforhealthcareadministrationandmanagementpositions. ● Education – Training in the Education courses will prepare the student for a career in imaging education (depending on minimumcourseenrollment). ● Mammography – Training in the Mammography courses will include all MQSA-mandated material and an emphasis on mammography registry review. This track will cover all ARRT® mammography exam content specifications, review the California state mammography exam, and include the required ARRT®16hoursofstructurededucationfortheMammographypost-primaryexamination. ● Computed Tomography – Training in the CT courses will consist of an overview of cross-sectional images of the body and offer didactic educational experiences that will provide the student with the necessary knowledge and skills to become an entry-level CT technologist. Students will learn the physics and instrumentation of computed tomography, clinical procedures and protocols, patient care, and radiation safety with a registry review to help prepare students for the ARRT® post-primary exam. The completion of this track will meet the ARRT® 16 hours of structured education for the CT post-primary examination. ● MRI (Magnetic Resonance Imaging) – Training in the MRI courses will include the didactic framework covering physical principles of MRI, advanced applications of MRI, including sectional anatomy, and MRI Safety and Registry Review. The completion of this track will meet the ARRT® 16 hoursofstructurededucationfortheMRIpost-primaryexamination. The B.S. in DMI degree is available entirely through the distance education delivery method. This program offers advancement for technologists who cannot attend a traditional college. The entire BSDMI program is 121 semester credit hours. Registered technologists may earn up to 70 semester credit hours of advanced standing. The courses are listed in the following table. They include courses that will enhance the student’s understandingofmedicalimagingandspecialtycoursesdependingontheirchosentrack. B.S. in DMI Program Goals and Objectives ● Developrequisiteskillstofunctioninadvancedroleswithintheimagingcommunity. ● Expandcommunicationskills. ● Demonstratethecriticalthinkingandproblem-solvingskillsofasupervisory-levelprofessional. ● Beadequatelypreparedtofunctionwithintheprofessioninadvancedroles. ● Developprofessionalismthroughscholarlyproductivity. ● Cultivatecritical thinking skills. ● Craftaworkingprofessionale-portfolio. Table 50. General Education Courses Total Course SemesterCredit Title Contact Number Hours Hours GE022 Anatomy&PhysiologyII(w/olab) 45.0 3.0 GE103 GrowthandDevelopmentthroughLifespan 45.0 3.0 GE111 ResearchStatistics 45.0 3.0 GE120 Introduction to Information Systems 45.0 3.0 GE202 GeneralPsychology 45.0 3.0 GE221 Written CommunicationforProfessionals 45.0 3.0 GE240 Public Speaking 45.0 3.0 TOTAL 315.0 21.0 207

Table 51. BSDMI Professional Courses Total Course SemesterCredit Title Contact Number Hours Hours DMI330 AdvancedRadiobiology 60.0 4.0 DMI340 Quality Control in Diagnostic Imaging 60.0 4.0 DMI360 Health Science Management 60.0 4.0 DMI370 Professional Capstone Portfolio Project 45.0 3.0 GEH101 Organization and Function of Health System 45.0 3.0 GEH301 Ethics & Law in Health Science 45.0 3.0 TOTAL 315.0 21.0 Chooseoneofthefollowingtracks Table 52. Leadership and Management Track Total Course SemesterCredit Title Contact Number Hours Hours DMI410 Leadership and Performance 45.0 3.0 Operations and HumanResourceManagementin DMI420 45.0 3.0 Diagnostic Imaging DMI430 Financial and Asset Management in Radiology 45.0 3.0 TOTAL 135.0 9.0 Table 53. Imaging Informatics Track Total Course SemesterCredit Title Contact Number Hours Hours DMI440 Digital Radiography and PACS 45.0 3.0 DMI450 CommunicationandEducationinImagingInformatics 45.0 3.0 DMI460 SystemsManagementinInformatics 45.0 3.0 TOTAL 135.0 9.0 Table 54. Education Track Total Course SemesterCredit Title Contact Number Hours Hours DMI470 Teaching Strategies for Adult Learners in Health Science 45.0 3.0 DMI480 Curriculum Design in Diagnostic Imaging Sciences 45.0 3.0 DMI490 MethodsofTeachingOnlineCourse 45.0 3.0 TOTAL 135.0 9.0 Table 55. Computed TomographyTrack Total Course SemesterCredit Title Contact Number Hours Hours 208

DMI510 Principles of Computed Tomography 45.0 3.0 DMI520 AdvancedApplicationinComputedTomography 45.0 3.0 DMI530 ComputedTomographyRegistryReview 45.0 3.0 TOTAL 135.0 9.0 Table 56. Magnetic Resonance Imaging Track Total Course SemesterCredit Title Contact Number Hours Hours DMI540 Physical Principles of MRI 45.0 3.0 DMI550 AdvancedApplicationsofMRI 45.0 3.0 DMI560 MRISafetyandRegistryReview 45.0 3.0 TOTAL 135.0 9.0 Table 57. MammographyTrack Total Course SemesterCredit Title Contact Number Hours Hours DMI570 Principles of Mammography 45.0 3.0 DMI580 AdvancedApplicationsofBreastImaging 45.0 3.0 DMI590 MammographyRegistryReview 45.0 3.0 TOTAL 135.0 9.0 BACHELOROFSCIENCEINNURSINGPROGRAM(BSN) 120WEEKS(GENERIC);63WEEKS(LVNTOBSN);45WEEKS (RNTOBSN) 120SEMESTERCREDITHOURS;2505CLOCKHOURS GENERICBACHELOR’SDEGREEPROGRAM,8SEMESTERS LVNTOBSN,4SEMESTERS;RNTOBSN,3SEMESTERS STANDARDOCCUPATIONALCLASSIFICATION (SOCCode):29-1141.00.29-1141.03,29-1141.01 POTENTIALOCCUPATIONS:Pleaseseeaschoolofficialforthe completelist of potential occupations. LOCATIONS:Concord DELIVERY:Blended(ResidentialandDistanceEducation) Gurnick AcademyofMedicalArtsstudentsintheclassroomattheFresnocampus. BSNProgramDescription Students will study a wide range of curricular content required for licensure by the California Board of Registered Nursing. Students will also study the organization and function of health services, ethics and law in health care, writing skills for health professionals, leadership and management, nursing research, and the essentials of patient education. Emphasis will be placed on evidence-based practice and critical thinking skills to provide safe and effective care to patients from diverse and multicultural populations and communities across the lifespan. Students will also 209

take Community Health Nursing, which includes certification in reporting child abuse and disaster management,followingtherequirementsofthePublicHealthCaliforniaCodeofRegulations. BSNProgramMissionStatement Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. The Bachelor of Science in Nursing aims to achieve distinction in the undergraduate nursing program and advancethemissionofGurnickAcademyofMedicalArtsthrough 1. Actively prepare the baccalaureate student to assume roles in nursing practice per the regulatory andaccrediting agencies. 2. Actively prepare the baccalaureate student to bear practice, education, and research responsibility. 3. Promoting public health by developing new knowledge and applying this knowledge to innovate healthcare delivery in a public health setting. 4. Provision of insight, assistance, and teaching of health care programs responding to the growing public health needs. 5. Championingnursingresearchandscholarships. BSNProgramGoals Thefaculty at Gurnick Academy of Medical Arts is committed to the following: 1. Providing a learning environment that nurtures cultural diversity and differences in learning styles andisfreeofdiscriminationandjudgment. 2. Graduate well-prepared Bachelor of Science in Nursing students who demonstrate clinical behaviors and judgments to meet the essential competencies necessary to obtain licensure and join the workforceasanentry-levelnurse. 3. Ensure that graduates have the knowledge and skills to respond to the community’s growing healthcare delivery and practice needs. 4. Produce well-rounded nurses who are culturally sensitive, situation-adaptive, and active advocates of the communityit serves. 5. Continuously revisit and revise its curriculum to ensure its nursing graduates adapt to rapid healthcare delivery and practice changes. 6. Build a learning platform to inspire nursing graduates to pursue recognition and excellence in practice, research, and community outreach. 7. Foster nurturing partnerships with its community organizations for academic programs. 8. Inspire nursing graduates to seek higher education by developing a plan for faculty growth and professional development. BSNTerminalEducationalOutcomes Bytheendofthebaccalaureatenursingprogram,thegraduatewillbeableto: 1. Apply theoretical and clinical concepts of health promotion and disease prevention practices, provide a safe and nurturing environment, and lead innovations in nursing practices according to nursing regulations and accrediting agencies. 2. Critically appraise, analyze, and create a framework integrating didactic and clinical learning into everydaypractice and leadership activities. 3. Evaluate patient care practices that are evidence-based and community-driven. 4. Express a firm commitment to nursing research through active participation in professional organizations and education advancement. 5. Demonstrate leadership by becoming well-rounded, ethical, respectful, well-informed, and fully responsive to the community’s needs. 210

BSNProgramOutline Table 58. Generic BSN Program Outline ABHES BRN Semester Course CourseTitle Clock Clock Credit Number Hours Hours Hours GE020A HumanBodyinHealth&DiseaseIw/Lab 75.0 90.0 4.0 GE041 GeneralMicrobiologywithLab 75.0 90.0 4.0 GE222 English Reading and Composition 45.0 45.0 3.0 GE112 AlgebraI 45.0 45.0 3.0 GE201 Introduction to Sociology 45.0 45.0 3.0 GE020B HumanBodyinHealth&DiseaseIIw/Lab 75.0 90.0 4.0 GE031 Nutrition in Health & Disease 45.0 45.0 3.0 GE202 GeneralPsychology 45.0 45.0 3.0 GE240 Public Speaking, Basics of Effective Communication 45.0 45.0 3.0 GE110 Critical Thinking 45.0 45.0 3.0 GE111 ResearchStatistics 45.0 45.0 3.0 GEH101 Organization & Function of Health Services 45.0 45.0 3.0 GEH102 Essentials of Patient Education 45.0 45.0 3.0 GE103 GrowthandDevelopmentThroughLifespan 45.0 45.0 3.0 GEH201 Holistic Health & Complimentary Alternative Medicine 30.0 30.0 2.0 GEH301 Ethics and Law in Health Science 45.0 45.0 3.0 RN100 FundamentalsofNursingTheory* 45.0 45.0 3.0 RN101 FundamentalsofNursingClinicalandLab* 157.5 157.5 3.5 RN102 Health AssessmentTheory* 45.0 45.0 3.0 RN103 Health AssessmentSkills Lab* 67.5 67.5 1.5 RN104 Pharmacology 45.0 45.0 3.0 RN106 Pathophysiology 30.0 30.0 3.0 RN200 Medical/Surgical I Theory-Introduction to Med/Surg* 45.0 45.0 3.0 RN201 Medical/Surgical I Clinical-Introduction to Med/Surg* 90.0 90.0 2.0 RN202 Medical/Surgical II Theory-Intermediate Med/Surg* 45.0 45.0 3.0 RN203 Medical/Surgical II Clinical-Intermediate Med/Surg* 90.0 90.0 2.0 RN300 MaternalNewbornTheory* 45.0 45.0 3.0 RN301 MaternalNewbornClinical* 67.5 67.5 1.5 RN302 CareofChildrenTheory* 45.0 45.0 3.0 RN303 CareofChildrenClinical* 67.5 67.5 1.5 RN304 Medical/Surgical III Theory-Advanced Med/Surg* 45.0 45.0 3.0 RN305 Medical/Surgical III Clinical-Advanced Med/Surg* 90.0 90.0 2.0 RN400 MentalHealthNursingTheory* 45.0 45.0 3.0 RN401 MentalHealthNursingClinical* 90.0 90.0 2.0 RN402 Medical/Surgical IV Theory-Complex/Critical Care 45.0 45.0 3.0 Med/Surg&Leadership* RN403 Medical/Surgical IV Clinical-Complex/Critical Care 90.0 90.0 2.0 Med/Surg&Leadership* RN404 CommunityHealthNursingTheory* 45.0 45.0 3.0 211

RN405 CommunityHealthNursingClinical* 90.0 90.0 2.0 RN500 Leadership/ManagementinNursingTheory 45.0 45.0 3.0 RN501 Leadership/ManagementinNursingClinical 90.0 90.0 2.0 RN502 Nursing Informatics 45.0 45.0 3.0 RN504 Nursing Research 45.0 45.0 3.0 RN505 Bachelors AchievementCapstonePortfolio 45.0 45.0 3.0 TOTAL 2,505.0 2,550.0 120.0 GeneralEducationCoursesareidentifiedinItalics. *Paired course. See the course description for more details. BSNProgram–LVNtoBSNAdvancedPlacementProgramOutline Prerequisite-General Education Courses LVN to BSN Advanced Placement (Can be completed at Gurnick AcademyofMedicalArtsorbecreditgranted) Table 59. LVN to BSN Advanced Placement General Education Outline ABHES BRN Semester Course CourseTitle Clock Clock Credit Number Hours Hours Hours GE020A HumanBodyinHealth&DiseaseIw/Lab 75.0 90.0 4.0 GE041 GeneralMicrobiologywithLab 75.0 90.0 4.0 GE222 English Reading and Composition 45.0 45.0 3.0 GE112 AlgebraI 45.0 45.0 3.0 GE201 Introduction to Sociology 45.0 45.0 3.0 GE020B HumanBodyinHealth&DiseaseIIw/Lab 75.0 90.0 4.0 GE031 Nutrition in Health & Disease 45.0 45.0 3.0 GE202 GeneralPsychology 45.0 45.0 3.0 GE240 Public Speaking, Basics of Effective Communication 45.0 45.0 3.0 GE110 Critical Thinking 45.0 45.0 3.0 TOTALGURNICKACADEMYGENERALEDUCATIONCOURSES 540.0 585.0 33.0 Prerequisite Nursing Courses: LVN to BSN Advanced Placement (These courses are to be credit granted for LVNs, subject to Credit Granting Policy). Table 60. LVN to BSN Advanced Placement Prerequisite Outline Semester Course CourseTitle Clock Hours Credit Number Hours RN100 FundamentalsofNursingTheory* 45.0 3.0 RN101 FundamentalsofNursingClinicalandLab* 157.5 3.5 RN102 Health AssessmentTheory* 45.0 3.0 RN103 Health AssessmentSkills Lab* 67.5 1.5 RN104 Pharmacology 45.0 3.0 RN200 Medical/Surgical I Theory-Introduction to Med/Surg* 45.0 3.0 RN201 Medical/Surgical I Clinical-Introduction to Med/Surg* 90.0 2.0 212

RN202 Medical/Surgical II Theory-Intermediate Med/Surg* 45.0 3.0 RN203 Medical/Surgical II Clinical-Intermediate Med/Surg* 90.0 2.0 TOTALNURSINGPREREQUISITECOURSES 630.0 24.0 *Paired course. See the course description for more details. Table 61. LVN to BSN Advanced Placement Admission Course Outline Semester Course CourseTitle Clock Hours Credit Number Hours Nursing Transition Advanced Placement Theory & Lab RN180 120.0 5.0 Course TOTALGURNICKACADEMYADMISSIONCOURSES 120.0 5.0 Table 62. LVN to BSN General Education Course Outline Semester Course CourseTitle Clock Hours Credit Number Hours GE111 ResearchStatistics 45.0 3.0 GEH101 Organization & Function of Health Services 45.0 3.0 GEH102 Essentials of Patient Education 45.0 3.0 GE103 GrowthandDevelopmentThroughLifespan 45.0 3.0 GEH201 Holistic Health & Complementary Alternative Medicine 30.0 2.0 GEH301 Ethics and Law in Health Science 45.0 3.0 TOTALGURNICKACADEMYGENERALEDUCATIONCOURSES 255.0 17.0 Table 63. LVN to BSN Advanced Placement Professional Course Outline Semester Course CourseTitle Clock Hours Credit Number Hours RN106 Pathophysiology 45.0 3.0 RN400 MentalHealthNursingTheory* 45.0 3.0 RN401 MentalHealthNursingClinical* 90.0 2.0 RN300 MaternalNewbornTheory* 45.0 3.0 RN301 MaternalNewbornClinical* 67.5 1.5 RN304 Medical/Surgical III Theory-Advanced Med/Surg* 45.0 3.0 RN305 Medical/Surgical III Clinical-Advanced Med/Surg* 90.0 2.0 RN302 CareofChildrenTheory* 45.0 3.0 RN303 CareofChildrenClinical* 67.5 1.5 RN402 Medical/Surgical IV Theory-Complex/Critical Care 45.0 3.0 Med/Surg&Leadership* RN403 Medical/Surgical IV Clinical-Complex/Critical Care 90.0 2.0 Med/Surg&Leadership* RN404 CommunityHealthNursingTheory* 45.0 3.0 213

RN405 CommunityHealthNursingClinical* 90.0 2.0 RN500 Leadership/ManagementinNursingTheory 45.0 3.0 RN501 Leadership/ManagementinNursingClinical 90.0 2.0 RN502 Nursing Informatics 45.0 3.0 RN504 Nursing Research Theory 45.0 3.0 RN505 Bachelors AchievementCapstonePortfolio 45.0 3.0 TOTALGURNICKACADEMYPROFESSIONALCOURSES 1,080.0 46.0 TOTALPROGRAMFORDEGREE(PrerequisitesplusProfessional) 2,505.0 120.0 BSNProgram–RNtoBSNProgramOutline Prerequisite-General Education Courses RN to BSN (Can be completed at Gurnick Academy of Medical Arts or be credit granted). Table 64. RN to BSN General Education Outline ABHES BRN Semester Course CourseTitle Clock Clock Credit Number Hours Hours Hours GE020A HumanBodyinHealth&DiseaseIw/Lab 75.0 90.0 4.0 GE041 GeneralMicrobiologywithLab 75.0 90.0 4.0 GE222 English Reading and Composition 45.0 45.0 3.0 GE112 AlgebraI 45.0 45.0 3.0 GE201 Introduction to Sociology 45.0 45.0 3.0 GE020B HumanBodyinHealth&DiseaseIIw/Lab 75.0 90.0 4.0 GE031 Nutrition in Health & Disease 45.0 45.0 3.0 GE202 GeneralPsychology 45.0 45.0 3.0 GE240 Public Speaking, Basics of Effective Communication 45.0 45.0 3.0 GE110 Critical Thinking 45.0 45.0 3.0 TOTAL 540.0 585.0 33.0 Prerequisite Nursing Courses: RN to BSN (These courses are to be credit granted for RNs, subject to the Credit Granting Policy). Table 65. RN to BSN Prerequisite Outline Semester Clock Course CourseTitle Credit Number Hours Hours RN100 FundamentalsofNursingTheory* 45.0 3.0 RN101 FundamentalsofNursingClinicalandLab* 157.5 3.5 RN102 Health AssessmentTheory* 45.0 3.0 RN103 Health AssessmentSkills Lab* 67.5 1.5 RN104 Pharmacology 45.0 3.0 RN106 Pathophysiology 45.0 3.0 RN200 Medical/Surgical I Theory-Introduction to Med/Surg* 45.0 3.0 RN201 Medical/Surgical I Clinical-Introduction to Med/Surg* 90.0 2.0 214

RN202 Medical/Surgical II Theory-Intermediate Med/Surg* 45.0 3.0 RN203 Medical/Surgical II Clinical-Intermediate Med/Surg* 90.0 2.0 RN300 MaternalNewbornTheory* 45.0 3.0 RN301 MaternalNewbornClinical* 67.5 1.5 RN302 CareofChildrenTheory* 45.0 3.0 RN303 CareofChildrenClinical* 67.5 1.5 RN304 Medical/Surgical III Theory-Advanced Med/Surg* 45.0 3.0 RN305 Medical/Surgical III Clinical-Advanced Med/Surg* 90.0 2.0 RN400 MentalHealthNursingTheory* 45.0 3.0 RN401 MentalHealthNursingClinical* 90.0 2.0 RN402 Medical/Surgical IV Theory-Complex/Critical Care 45.0 3.0 Med/Surg&Leadership* RN403 Medical/Surgical IV Clinical-Complex/Critical Care 90.0 2.0 Med/Surg&Leadership* TOTALNURSINGPREREQUISITECOURSES 1,305.0 51.0 *Paired course. See the course description for more details. Table 66. RN to BSN General Education Course Outline Semester Course Clock CourseTitle Credit Number Hours Hours GE111 ResearchStatistics 45.0 3.0 GEH101 Organization & Function of Health Services 45.0 3.0 GEH102 Essentials of Patient Education 45.0 3.0 GE103 GrowthandDevelopmentThroughLifespan 45.0 3.0 GEH201 Holistic Health & Complementary Alternative Medicine 30.0 2.0 GEH301 Ethics and Law in Health Science 45.0 3.0 TOTALGURNICKACADEMYGENERALEDUCATIONCOURSES 255.0 17.0 Table 67. RN to BSN Professional Course Outline Semester Course Clock CourseTitle Credit Number Hours Hours RN404 CommunityHealthNursingTheory* 45.0 3.0 RN405 CommunityHealthNursingPracticum* 90.0 2.0 RN500 Leadership/ManagementinNursingTheory 45.0 3.0 RN501 Leadership/ManagementinNursingClinical 90.0 2.0 RN502 Nursing Informatics 45.0 3.0 RN504 Nursing Research Theory 45.0 3.0 RN505 Bachelors AchievementCapstonePortfolio 45.0 3.0 TOTALGURNICKACADEMYPROFESSIONALCOURSES 405.0 19.0 TOTALPROGRAMFORDEGREE(PrerequisitesplusProfessional) 2,505.0 120.0 *Paired course. See the course description for more details. 215

BSNProgramInformation,Length,andSchedule TheBSNisadegreeprogramprovidingalibraryandclassroomswithaudiovisualteachingaids,textbooks, journals, anatomical charts, and models. The Instructor-to-Student ratio is 1:12 in the laboratory and clinical, 1:28 during residential lectures, and 1:25 during online lectures. TheBSNprogramisdesignedwiththree(3)separateadmissionpathwaysforfull-timeattendance. Generic BSN(8semestersfor120SemesterCreditHours): In the first three (3) program semesters, students will take 50 Semester-Credit Hours of General Education courses via online delivery. The fourth semester is 15 weeks and consists of 14 Semester Credit Hours (nine (9) lecture and five (5) clinical and skills lab hours). Courses include Fundamentals of Nursing, including theory, skills and clinical, Health Assessment, and Pharmacology. Theory and Lab will be held Monday through Friday. The clinical schedule may vary depending on clinical site availability. The fifth semester consists of 13 Semester Credit Hours (nine (9) lecture and four (4) clinical hours). Courses include Pathophysiology, Introduction to Med/Surg I Theory and Clinical, and Intermediate Med/Surg Theory and Clinical. Classes will be held Monday through Friday. The clinical schedule may vary depending on clinical site availability. The sixth semester consists of 14.5 Semester Credit Hours (nine (9) lecture and 5.5 clinical hours). Courses include Mental Health Theory and Clinical, Maternal/Newborn Theory and Clinical, and Advanced Med/Surg I Theory and Clinical. Theory and Lab will be held Monday through Friday. The clinical schedule may vary dependingonclinicalsite availability. The seventh semester consists of 14.5 Semester Credit Hours (nine (9) lecture and 5.5 clinical hours). Courses include Care of Children Theory and Clinical, Complex Med-Surg Theory and Clinical/Leadership, and Community Health Theory and Practicum. Classes will be held Monday through Friday. The clinical schedule mayvarydependingonclinicalsiteavailability. The eighth semester consists of 14 Semester Credit Hours (12 lecture and two (2) clinical hours). Courses include Leadership Theory and Practicum, Nursing Research, Nursing Informatics, and BSN Capstone Portfolio. Classes will be held Monday through Friday. The clinical schedule may vary depending on clinical site availability. Students receive 1,425 didactic hours and 1,080 clinical and lab hours during this pathway, allowing them to apply the lecture topics to practical use. LVNtoBSNAdvancedPlacement(4semestersfor63SemesterCreditHours): Students in this pathway can complete the BSN program within 63 weeks (four (4) semesters and a three (3) weekLVNtoRNtransitioncourse),assumingmaximumcreditgrantingfornursingandGEcourses. AnadmissioncourseisrequiredforallstudentselectingtoenrollintheLVNtoRNAdvancedPlacementtrack. TheRN180NursingAdvancedPlacementTransitionTheory&Labistheadmissioncourse.Itisafive(5)unit, 120-hourcoursethatevaluatesthestudent’sreadinesstoenrollintheAdvancedPlacementpathway.The student must demonstrate the required knowledge and skills to complete this course. All students must completethesebeforestartinganyProfessionalCourses. 216

Thethirdsemesteris17SemesterCreditHoursofGeneralEducationCoursesviaonlinedelivery.Thefourthand fifth semesters with 24 semester credit hours are credits granted from LVN Education. Thesixthsemesterconsistsof17.5SemesterCreditHours(12lectureand5.5clinicalhours).Coursesinclude Pathophysiology, Mental Health Theory and Clinical, Maternal/Newborn Theory and Clinical, and Advanced Med/SurgITheoryandClinical.TheoryandLabwillbeheldMondaythroughFriday.Theclinicalschedulemay vary depending on clinical site availability. Theseventhsemesterconsistsof14.5SemesterCreditHours(nine(9)lectureand5.5clinicalhours).Courses include Care of Children Theory and Clinical, Complex Med-Surg Theory and Clinical/Leadership, and CommunityHealthTheoryandPracticum.ClasseswillbeheldMondaythroughFriday.Theclinicalschedule mayvarydependingonclinicalsiteavailability. Theeighthsemesterconsistsof14SemesterCreditHours(12lectureandtwo(2)clinicalhours).Courses include Leadership Theory and Practicum, Nursing Research, Nursing Informatics, and BSN Capstone Portfolio. Classes will be held Monday through Friday. The clinical schedule may vary depending on clinical site availability. Students receive 802.5 hours of didactic and 652.5 hours of clinical and lab instruction in this pathway, allowing themtoapplythelecturetopicstopracticaluse.Theexpectedprogramcompletiontimeis63weeks,excluding holidays and vacations. Gurnick AcademyofMedicalArtshasadoptedATIstandardizedtestingtoassessstudentlearningoutcomesand evaluate student readiness for the nursing licensure examination. The NCLEX Preparation and Remediation course assists students in this program by focusing directly on the current NCLEX-RN test plan, application process, and test-taking strategies to prepare for the NCLEX-RN licensure exam. Preparation for NCLEX-RN (ATI) is provided to the students. Students are permitted two (2) attempts to pass the ATI exit exam to graduate. The first attempt is given after program completion. The second attempt is given two (2) weeks after program completion. Under extraordinary circumstances, applicable students may be eligible for athird attempt. See the Student Grievance and Appeals Policy for more information. RNtoBSNAdvancedPlacement(3semestersfor36SemesterCreditHours): The Bachelor of Science in Nursing program (RN to BSN) admission track is a three (3) semester distance education program for RNs to complete their Bachelor of Science Degree in Nursing in one (1) year. Each semester is 15 weeks long and covers five (5) courses. Course instructors will open a new lecture each weekday, and assignments must be submitted by the deadlines set by the course instructors and indicated in the course syllabi.  The two (2) practicum courses, Community Health Nursing Practicum and Leadership/Management in Nursing Practicum, require the student to do six (6) hours each week for 15 weeks in a clinical setting. Students are responsible for obtaining their local clinical site/preceptor based on their work or residence. Gurnick Academy of Medical Arts has agreements with multiple clinical sites in the Bay Area, California, where students can alternatively complete their clinical/preceptorship. The expected program completion time is 45 weeks, excluding holidays and vacation times. The Instructor-to-Student ratio is 1:25 during lectures and 1:1 during clinical externships. 217

At Gurnick Academy of Medical Arts (professional courses only), students receive 480 hours of didactic instruction and 180 hours of clinical teaching, allowing them to apply the lecture topics to practical use. Additionally, students will dedicate 960 hours toward outside-of-school preparation time. BACHELOROFSCIENCEINRADIATIONTHERAPY(B.S.inRT) 135WEEKS 3100CLOCKHOURS 131SEMESTERCREDITHOURS BACHELOROFSCIENCEDEGREEPROGRAM,9SEMESTERS STANDARDOCCUPATIONALCLASSIFICATION (SOCCode):29-1124.00 POTENTIAL OCCUPATION: Please see a school official for the complete list of potential occupations. LOCATIONS:VanNuys DELIVERY:Full Distance Education Stock photo from canva.com. B.S. in RT Program Mission Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. The Radiation Therapy Program at Gurnick Academy of Medical Arts aims to provide the highest quality of didactic and clinical education for students to assume the role of a radiation therapist. Graduates of the Radiation Therapy program will be knowledgeable, both clinically and technically competent, and proficient in critical thinking to provide exceptional patient care, education, simulation, and treatment. B.S. in RT Program Goals and Description The Bachelor of Science in Radiation Therapy Program (B.S. in RT) is a 36-month program that prepares students to obtain the professional role of an entry-level radiation therapist. This full-time, lock-step program provides students with didactic and clinical learning experiences that prepare them to be vital healthcare team members. This program includes online classwork, live online lectures, and clinical experiences contributing to student learning. Beginning with general education courses, students will build upon their knowledge as they progress throughtheprogramintocoreradiationtherapycoursework. The radiation therapy curriculum, developed by the American Society of Radiologic Technologists, ensures students develop essential skills for working with diverse patients. These skills include communication, human diversity, scientific inquiry, critical thinking, and judgment. The didactic radiation therapy courses include human anatomy, physiology, radiation therapy physics, radiation oncology, pathology, radiation biology, treatmentplanning, medical dosimetry, quality assurance, and patient care. During the clinical portion of the program, students will be under the direct supervision of a licensed radiation therapist as they develop competencies in simulation, treatment, and dosimetric procedures. Students will utilize various simulation and treatment machines to elevate their skills and consistently deliver high-quality patient care. B.S. in RT Program Goals and Objectives 1. Students will be clinically competent in simulation and the delivery of radiation therapy treatments. 218

a. Students will demonstrate clinical competence in simulation and radiation therapy treatment delivery. b. Students will demonstrate mastery of knowledge and clinical reasoning. c. Students will demonstrate ALARA principles. 2. Students will communicate effectively. a. Students will effectively communicate with patients, therapists, physicians, and staff. b. Applyappropriatecommunicationskillsacrosssettings, purposes, and audiences. c. Demonstratetheabilitytocommunicatewithculturallydiversepopulations. 3. Students will utilize problem-solving skills and develop critical thinking skills. a. Applyappropriatecommunicationskillsacrosssettings, purposes, and audiences. b. Developconclusionsandrelatedoutcomes. c. Students will demonstrate mastery of knowledge and clinical reasoning. 4. Students will demonstrate standards of professionalism through ethical behaviors. a. Students will demonstrate ethical behaviors. b. Demonstrateattitudesandbehaviorsconsistentwithprofessionalstandards. B.S. in RT Program Outline Table 68. B.S. in RT Program Course Outline Course Clock Semester Title Number Hours Credit Hours GE002 Principles of Physics 45.0 3.0 GE020A HumanBodyinHealth&DiseaseIwithLaboratory 75.0 4.0 GE020B HumanBodyinHealth&DiseaseIIwithLaboratory 75.0 4.0 GE031 Nutrition in Health and Disease 45.0 3.0 GE041 GeneralMicrobiologywithLaboratory 75.0 4.0 GE103 GrowthandDevelopmentThroughLifespan 45.0 3.0 GE110 Critical Thinking 45.0 3.0 GE112 Algebra I 45.0 3.0 GE120 Introduction to Information Systems 45.0 3.0 GE201 Introduction to Sociology 45.0 3.0 GE202 GeneralPsychology 45.0 3.0 GE222 English Reading and Composition 45.0 3.0 GE240 Public Speaking, Basics of Effective Communication 45.0 3.0 GEH101 Organization and Function of Health Services 45.0 3.0 RTT250 Introduction to Radiation Therapy 30.0 2.0 RTT300 Sectional/Topographic Anatomy 45.0 3.0 RTT315 MedicalImaging 45.0 3.0 RTT320 Clinical Concepts I 45.0 3.0 RTT330 Ethics 25.0 1.5 219

RTT340 Radiation Therapy Patient Care 45.0 3.0 RTT355 Clinical Oncology 45.0 3.0 RTT365 Clinical Concepts II 45.0 3.0 RTT400 Clinical Radiation Therapy Physics I 60.0 4.0 RTT410 Clinical Radiation Therapy Physics II 60.0 4.0 RTT420 Quality Management 45.0 3.0 RTT430 ResearchinRadiationTherapy 45.0 3.0 RTT440 Dosimetry 45.0 3.0 RTT450 Operational Issues 30.0 2.0 RTT460 Radiobiology 45.0 3.0 RTT470 Radiation Therapy Clinical Externship I 570.0 12.5 RTT471 SeminarinRadiationTherapyI 15.0 1.0 RTT475 Radiation Therapy Clinical Externship II 570.0 12.5 RTT476 SeminarinRadiationTherapyII 15.0 1.0 RTT485 Radiation Therapy Clinical Externship III 480.0 10.5 RTT486 SeminarinRadiationTherapyIII 15.0 1.0 RTT490 Radiation Therapy Capstone 60.0 4.0 TOTAL 3,100.0 131.0 B.S. in RT Program Information, Length, and Schedule The program information, length, and schedule may change. Read the accompanying Addendum for changes andupdates,andcheckwithanAdmissionAdvisorfordetails. The Radiation Therapy program is a Bachelor of Science degree program. The student will receive didactic, laboratory, and clinical experience in affiliated medical facilities. The instructor-to-student ratio is as follows: online lectures 1:25 and clinical 1:1. The program consists of nine (9) 15-week semesters. Students will take General Education courses and one (1) introductory course for up to 20 hours per week during the first three (3) semesters. Students will take technical courses for the last six (6) semesters. Clinical rotations start in semester five (5). Classes may be scheduled Monday through Sunday. Students will attend up to forty (40) hours per week of instruction, including didactic, labs, and clinical. Clinical activities may be held during weekdays as required by theclinical site. Didactic courses are held between 8:00 AM to 8:00 PM. Students receive 1,480 didactic and laboratory instruction hours and 1,620 clinical education hours, allowing themtoapplythelecturetopicstopracticaluse. 220

BONEDENSITOMETRYTECHNICIANPROGRAM(DXA) 5WEEKS 56CLOCKHOURS 4QUARTERCREDITHOURS CERTIFICATEPROGRAM STANDARDOCCUPATIONALCLASSIFICATION(SOCCode): 31-9099.00 POTENTIALOCCUPATIONS:Pleaseseeaschoolofficialforthe completelist of potential occupations. LOCATION:Sacramento DELIVERY:Blended(ResidentialandDistanceEducation) Stock photo from canva.com. DXAProgramMission Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. DXAProgramDescription The Bone Densitometry Technician Program prepares competent imaging professionals committed to professionalism, ethical behavior, technical knowledge, radiation protection, and patient care. Students who complete this program may pursue an entry-level position as a Bone Densitometry at physician’s offices, imagingcenters, and research and governmental offices. GraduateswhocompletetheprogrammustpasstheCaliforniaStateExaminationtosecureapositionasaBone Densitometry Technician. Duties include patient assessment, patient care, machine operation, scanning protocols, analysis of anatomy and generating reports. DXAProgramGoalsandObjectives ● Graduatestudentswiththeclinicalcompetencerequiredtobeanentry-leveltechnician. ● Producestudentswhowilldemonstrateeffectiveinterpersonalskillswiththeentirehealthcareteam andthepublic. ● Enable students to employ appropriate critical thinking and problem-solving skills to be entry-level technicians in the clinical setting. DXAProgramStudentLearningOutcomes ● Demonstratepositioningskillsofanentry-leveltechnician. ● Evaluateimagesfordiagnosticquality. ● Employeffectivecommunicationskillswiththehealthcareteam. ● Exhibitcommunicationskillswiththepatientsandthepublic. ● Abilitytoadapttopatients’conditionsthatdeviatefromroutineexams. ● UtilizepropersafetyandALARApracticesforroutineandnon-routineexams. DXAProgramOutline Table 69. DXA Program Course Outline Course Quarter Title Clock Hours Number Credit Hours 221

DXA101 FundamentalsofBoneDensitometry 40.0 3.5 DXA101C Clinical Practice I 16.0 0.5 TOTAL 56.0 4.0 DXAProgramInformation,Length,andSchedule The program information, length, and schedule may change. Please read the accompanying Addendum for changesandupdates,andcontactanAdmissionsadvisorformoredetailedinformation. The Gurnick AcademyofMedicalArtsBoneDensitometryTechnicianProgramprovidesalibraryandclassrooms with teaching aids, textbooks, journals, periodicals, and anatomical charts. The Bone Densitometry Technician Program is a certificate program. The students will receive didactic and clinical experience in affiliated medical facilities. The Instructor-to-Student ratio is 1:25 during online lectures and1:1duringclinical externships. Classes may be scheduled Monday through Sunday. Students will attend a maximum of 40 hours per week of instruction, including didactic lectures and clinicals. Clinical activities may be held on weekdays or weekends, and shifts may include days or evenings as the clinical site requires. Didactic courses are held between 8:00 AM to 10:30 PM. Theprogram’saffiliated clinical sites hold current state-issued certificates as approved clinical sites. The clinical sites provide supervised clinical instruction in the patient care setting. All clinical sites employ X-ray technicians or Radiologic Technologists and supervisors/operators (Doctors) who hold certification issued by the State of California Radiologic Health Branch. The Bone Densitometry Technician Program consists of 4.0 quarter credit hours, completed over five (5) weeks for fifty-six (56) contact hours. Day/Evening classes are currently scheduled for the program. Please refer to the course schedule for details. Before graduating, students must complete all didactic and clinical hours. DENTALASSISTANTPROGRAM(DA) 32WEEKS 946.5CLOCKHOURS 42.5 QUARTERCREDITHOURS CERTIFICATEPROGRAM,8MODULES STANDARDOCCUPATIONALCLASSIFICATION(SOCCode):31-9091.00, 43-6013.00 POTENTIALOCCUPATIONS:Pleaseseeaschoolofficialforthecomplete list of potential occupations. LOCATION:Modesto DELIVERY:Blended(ResidentialandDistanceEducation) AGurnickAcademyofMedicalArtsinstructorwithastudentintheDentalAssistantSkillsLabattheModestocampus. DAProgramMission Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. DAProgramDescription 222

A Dental Assistant works in a dental office or other dental facility and is considered an indispensable partner on the team. A Dental Assistant performs various administrative and clinical tasks. Dental Assistant program students learn the principles of front and back-office dental assisting. They will be introduced to the anatomy andphysiologyfundamentalsoftheoralcavity. Students will practice and become adept at various clinical skills, including patient education, chair-side assistance, X-rays, and coronal polishing. The program includes didactic, hands-on laboratory training and a clinical externship component where each student will be placed in a dental office or facility. DAProgramGoalsandObjectives ● Graduate students demonstrate theknowledgeandskillsrequiredofacompetententry-leveldental assistant. ● Provide quality education and training that develops the potential of each student to become a productive, responsible, and professional member of society, as well as a skilled member of the dental assisting workforce. ● Foster open access and a supportive environment to encourage student success in the classroom, laboratory, and externship sites. ● Prepare students to organize, prioritize, and delegate care by communicating effectively with dental teammembers. ● AdheretoprofessionalstandardsincorporatingaDentalAssistant’slegalandethicalresponsibilities. ● Encourageprofessionalism,integrity, and high standards in students. ● Heedprofessionalstandardsincorporatinglegalandethicalresponsibilities. DAProgramOutline Table 70. DA Program Course Outline Total Quarter Course Clock Outside-of-School Title Clock Credit Number Hours Preparation Hours Hours Hours DA100 Infection Control 8.0 2.5 10.5 0.5 DA200 FundamentalsofDentalAssisting 96.0 30.0 126.0 6.0 Sciences of Dentistry/Infection DA201 96.0 30.0 126.0 6.0 Prevention DA202 FoundationofClinical Dentistry 96.0 30.0 126.0 6.0 DA203 Dental Materials/Coronal Polishing 96.0 30.0 126.0 6.0 DA204 Radiology Safety/Administrative 96.0 30.0 126.0 6.0 Dental Specialties/Patient DA205 96.0 30.0 126.0 6.0 Assessment DA300 Clinical Externship 180.0 — 180.0 6.0 TOTAL 764.0 182.5 946.5 42.5 DAProgramInformation,Length,andSchedule Theprograminformation,length,andschedulemaychange. TheDentalAssistantprogramprovidesalibraryandclassroomswithaudiovisualteachingaids,textbooks,and simulators. The Instructor-to-Student ratio is 1:12 in the laboratory, 1:30 during residential lectures, and 1:25 during online lectures. Classes begin every twelve (12) weeks. 223

Theprogramcomprisesseven(7)didactic/laboratorycoursesinfour-weekblocks.DA100-Infectioncontrolis taught before the students start any other courses. After completing the DA-100 course, students will take and completeallothercourses.DA200-202,andDA202-205aretaughtinsequencedependingonthequarterof thestart. Students must complete all didactic/laboratory courses before starting the DA 300 Externship course. Students must be available for didactic and laboratory coursework from 8:00 AM to 6:00 PM Monday through Friday. Students may be required to accommodate alternative schedules based on facility placement business hoursduringtheexternship.Studentsmustbeabletocompletethoseparticularrotationsontheschedule provided. Students receive 200 hours of didactic lectures, 384 hours of laboratory instruction time, and 180 hours of clinical externship. This allows students to apply their lecture topics and hands-on lab skills in practical use whenplacedinadentalfacility.Studentswillbetakingtechnicalcourses,whichmaybegivenoncampus, online, or a combination of the formats. Theminimumrequiredoutsideworktimeforstudentsis182.5hours.Thecurriculumprovidesstudentswith thetechnical, clinical, and interpersonal skills necessary to succeed in the dental assisting field. A certificate is awardeduponprogramcompletion.Theexpectedprogramcompletiontimeis32weeks,excludingholidays andvacationtimes. Class times can and may be rescheduled on an alternate day of the week (Sunday through Saturday) to ensure on-timeprogramcompletionandfulfillmentofrequiredprogramhours. LabHours Lab hours are completed with daily theory delivery and are conducted under instructor guidance and supervision. OutsideWork Assignmentswill vary daily according to topics, be done on students’ own time, and be given due dates. Clinical Externship The clinical externship includes student placement in a facility that performs various skills and provides exposure to theory concepts and hands-on practice opportunities. The externship allows students to assist facility staff with daily duties under supervision in the front and back offices. This marks the transition from being a student to becoming a dental assistant. The externship is a practicum without pay to help students apply learned classroom skills. Students will have various tasks to perform and document for verification purposes. Daily attendance and performance at the site are verified by facility personnel. MASTEROFSCIENCEINNURSINGPROGRAM(BSNtoMSN) 90WEEKS 36SEMESTERCREDITHOURS;540CLOCKHOURS 6SEMESTERS STANDARDOCCUPATIONALCLASSIFICATION (SOCCode):29-1141.00.29-1151.00,29-1161.01,29-1171.00 POTENTIAL OCCUPATIONS: Please see a school official for the complete list of potential occupations. LOCATIONS:Concord 224

DELIVERY:Online Gurnick AcademyofMedicalArtsstudentsintheclassroomattheSacramentocampus. MSNProgramDescription The Master of Science in Nursing (MSN) program prepares students at an advanced level, emphasizing nursing scholarship. Students will study healthcare policy, advanced research, healthcare informatics, leadership and management, financial resource management, curriculum development, teaching and learning process, assessmentandevaluationoflearning,andpracticumcapstonecourses. Emphasis will be placed on evidence-based practice, professional development, and scholarly practice, preparing nursing professionals with advanced theoretical skills and applied research methods. MSNProgramMissionStatement TheMasterofScienceinNursingprogram(MSN)isbasedonthemissionofGurnickAcademyofMedicalArtsto promote the intellectual, cultural, social, and ethical development of the learner addressing healthcare of diverse individuals, families, groups, communities, and populations through formal and informal teaching and learning processes. The MSN educationpreparesefficientnursesforflexible leadership and critical action within complex, changing systems, including health, educational, and organizational systems. The curriculum instills nurses with vital knowledge and skills to promote health, lead change, and elevate advanced care in various roles and diverse environments. The purpose of the Master of Science in Nursing is to achieve distinction in the graduate nursing program and to advance the mission of Gurnick Academy of Medical Arts by 1. Leading change to improve quality outcomes, building collaborative interprofessional care teams, andassumingrolesinadvancednursingpracticepertheregulatoryandaccreditingagencies. 2. Active preparation of the baccalaureate student to demonstrate critical thinking skills and innovative leadership in practice, education, and research. 3. Promoting public health by designing novel nursing practices and transforming evidence into practice in a diverse health setting. 4. Raise awareness, assistance, and teaching of health care programs in response to the growing public health needs and acuity. 5. Beachampionandadvocatefornursingresearchandscholarship. MSNProgramGoals At the graduate level, the goal is to develop knowledgeable and professional nurses who can unify practice with theory and advanced research to provide leadership, education, and service to healthcare stakeholders and the profession. Thefaculty at Gurnick Academy of Medical Arts is committed to the following: 1. Providing a learning environment celebrating cultural diversity and differences in learning styles and is free of judgment and discrimination. 2. Graduate well-prepared Master of Science in Nursing students who demonstrate confidence in clinical behaviors and knowledge in advanced healthcare practice, meeting the essential competenciesnecessarytojointheworkforce. 3. Ensure that graduates have the required knowledge and vital skills to respond to the community’s growinghealthcaredelivery and practice needs. 4. Produce well-rounded nurses who are culturally sensitive, situation-adaptive, and active advocates 225

of the stakeholders and community it serves. 5. Ongoing visits to its curriculum and revising as needed, ensuring that its nursing graduates can adapt to rapid healthcare delivery and practice changes. 6. Develop a learning platform inspiring its nursing graduates to continuously pursue recognition and excellence in practice, research, and community outreach. 7. Encouragenurturingpartnershipswithitscommunityorganizationsforacademicprograms. 8. Motivate nursing graduates to seek higher education by developing a plan for faculty growth and professional development. MSNTerminalEducationalOutcomes Bytheendofthegraduatenursingprogram,thestudentwillbeableto: 1. Apply theoretical and clinical concepts of health promotion and disease prevention practices, provide a safe and nurturing environment, and lead innovations in nursing practices according to nursing regulations and accrediting agencies. 2. Critically appraise, analyze, and create a framework integrating didactic and clinical learning into everydaypractice and leadership activities. 3. Evaluate patient care practices that are evidence-based and community-driven. 4. Strongly commit to nursing research by actively participating in professional organizations and advancingeducation. 5. Demonstrate leadership by becoming a well-rounded, ethical, respectful, and well-informed nurse whofullyrespondstotheneedsandunderstandingofthecommunityitserves. MSNProgram–BSNtoMSNProgramOutline Table 71. BSN to MSN Program Course Outline Course SemesterCredit CourseTitle Clock Hours Number Hours MSN506 Theoretical Foundations of Advanced Nursing 45.0 3.0 Practice MSN508 Future of Nursing & Healthcare Policy 45.0 3.0 MSN510 AdvancedResearchMethodologiesand 45.0 3.0 Analysis-Evidence Based Practice MSN512 Financial Resource Management 45.0 3.0 MSN514 Leadership and ManagementinNursingand 45.0 3.0 Healthcare MSN516 AdvancedHealthcareTechnology&Informatics 45.0 3.0 MSN600 AdvancedHealthAssessment,Pathophysiology, 45.0 3.0 Pharmacology MSN602 Curriculum Development 45.0 3.0 MSN604 Teaching and Learning Process and Strategies 45.0 3.0 MSN605 Nursing Practicum A – Clinical Nurse Educator 45.0 3.0 MSN606 AssessmentandEvaluationofLearning 45.0 3.0 MSN607 Nursing Practicum B – Academic Nurse Educator 45.0 3.0 TOTAL 540.0 36.0 MSNProgramInformation,Length,andSchedule The Master of Science in Nursing program (BSN to MSN) admission track is a six (6) semester distance education program for RNs to complete their Master of Science Degree in Nursing in two (2) years. Each 226

semester is 15 weeks long and covers two (2) courses. Course instructors will open a new lecture each weekday, and assignments must be submitted by the deadlines set by the course instructors and indicated in the course syllabi.  At Gurnick Academy of Medical Arts, students receive 540 didactic instruction hours. The two (2) practicum courses require the student to do five to six (5 – 6) hours each week with a preceptor for eight (8) weeks. Students must obtain their local preceptor based on their work or residence. Gurnick Academy of Medical Arts has agreements with multiple healthcare facilities in the Bay Area, California, where students can alternatively completetheirpracticum. The expected program completion time is 90 weeks, excluding holidays and vacation times. The Instructor-to-Student ratio is 1:25 during lectures and 1:1 during clinical externships. At Gurnick Academy of Medical Arts (professional courses only), students receive 540 hours of didactic instruction. MEDICALASSISTANTPROGRAM(MA) 30WEEKS 948.5CLOCKHOURS 44.5 QUARTERCREDITHOURS CERTIFICATEPROGRAM,3MODULES STANDARDOCCUPATIONALCLASSIFICATION(SOCCode): 31-9092.00, 43-6013.00, 31-9094.00 POTENTIALOCCUPATIONS:Pleaseseeaschoolofficialforthe completelist of potential occupations. LOCATIONS:ConcordandModesto DELIVERY:Blended(ResidentialandDistanceEducation) Gurnick AcademyofMedicalArtsstudentsintheMedicalAssistantSkillsLabattheFresnocampus. MAProgramMission Gurnick AcademyofMedicalArtsaimstoofferqualityalliedhealthandnursingprogramsthatintegrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. MAProgramDescription Gurnick AcademyofMedicalArtsMedicalAssistantgraduatesjointhehealthcarefield.MedicalAssistantsarea vital part of the healthcare team, and they complete administrative and clinical tasks in physicians’ offices, hospitals, and other healthcare facilities. Students will practice and become adept at various clinical skills, including patient education, phlebotomy, and performing first aid. MAProgramOutline Table 72. MA ProgramCourseOutline Course Clock OutsideofSchool Total Clock Quarter Title Number Hours Preparation Hours Hours Credit Hours MA100 Front Office Records Management 82.5 27.5 110.0 5.5 MA101 Front Office Finances 82.5 27.5 110.0 5.5 227

Front Office The Medical MA102 82.5 27.5 110.0 5.5 Professional AnatomyandPhysiologyfor MA107 19.0 7.5 26.5 1.5 MedicalAssistant I AnatomyandPhysiologyfor MA108 19.0 7.5 26.5 1.5 MedicalAssistant II AnatomyandPhysiologyfor MA109 18.0 7.5 25.5 1.5 MedicalAssistant III MA120A MedicalTerminologyA 15.0 5.0 20.0 1.0 MA120B MedicalTerminologyB 15.0 5.0 20.0 1.0 MA200 BackOfficeClinical Foundations 80.0 25.0 105.5 5.0 MA201 BackOfficeClinical Skills 80.0 25.0 105.5 5.0 MA202 BackOfficeClinical Laboratory 82.5 27.5 110.0 5.5 MA300 Clinical Externship 180.0 0.0 180.0 6.0 TOTAL 756.0 192.5 948.5 44.5 MAProgramGoalsandObjectives ● Administer quality education and training that develops the potential of each student to become a productive, responsible, and professional member of society, as well as a skilled member of the medicalassisting workforce. ● Prepare competent entry-level medical assistants in the cognitive (knowledge), psychomotor (skills), andaffective (behavior) learning domains. ● Foster open access and a supportive environment to encourage student success in the classroom, laboratory, and externship sites. ● Encourageprofessionalism,integrity, and high standards in students. ● Adhere to professional standards incorporating the legal and ethical responsibilities of medical assistants. ● Train students to organize, prioritize, and delegate care by communicating effectively with medical teammembers. ● Develop and apply knowledge of specific disease conditions in the prevention, treatment, and well-being of the patients. ● Equip students to take the Certified Clinical Medical Assistant (CCMA-NHA) and Certified EKG Technician (CET-NHA) national exams. MAProgramInformation,Length,andSchedule Theprograminformation,length,andschedulemaychange.ReadtheaccompanyingAddendumforchanges andupdates,andconnectwithanAdmissionAdvisorfordetails. TheMedicalAssistantprogramprovidesalibraryandclassroomswithaudiovisualteachingaids,textbooks,and simulators. The Instructor-to-Student ratio is 1:15 in the laboratory, 1:30 during residential lectures, and 1:25 during online lectures. The program consists of 13 courses contained in three (3) modules. Students must be available four (4) hours daily, Monday through Friday, for didactic and laboratory coursework. 228

WhileonExternship,studentsmustbeavailable40hoursperweek,MondaythroughFriday,andtheymaybe required to accommodatealternative schedules based on facility placement business hours. Students must be able to complete those particular rotations on the schedule provided. Students receive 231 didactic hours, 345 laboratory hours, and one hundred eighty (180) hours of clinical externships, allowing them to apply the lecture topics and hands-on lab skills in practical use when placed in a healthcare facility. 192.5 hours will be spent outside work time. Thecurriculumprovidesstudentswiththetechnical,clinical, and interpersonal skills necessary to succeed in themedicalassisting field. A certificate is awarded upon program completion. The expected program completiontimeis30weeks,excludingholidaysandvacationtimes. Class times can and may be rescheduled to ensure on-time program completion and fulfillment of required programhours. LabHours Labhoursaredonewithdailytheorydeliveryandareconductedunderinstructorguidanceandsupervision. OutsideWork Theinstructor will assign work correlating daily theory topics and skills. Assignments will vary according to topics, to be done on students’ own time, and given due dates. Certification Exam Review Students receive Certification Exam tutorial materials and practice examinations. These tools are utilized throughoutthefirst 24 weeks of the program to support student preparation for the certification exam. Specific distance education hours are designated each week for students to review key concepts to prepare for theexamination.Further, the resulting diagnostic data is utilized to counsel and guide students to strengthen their knowledge in each examination area. Clinical Externship Theclinical externship includes student placement in a facility that performs various skills and provides exposuretotheoryconceptsandhands-onpracticeopportunities.Theexternshipallowsstudentstoassist facility staff with daily duties under supervision in the front and back offices. This marks the transition from being a student to becoming a medical assistant. Theexternshipisapracticumwithoutpaytohelpstudentsapplylearnedclassroomskills.Studentswillhave various tasks to perform and to document for verification purposes. Daily attendance and performance at the site are verified by facility personnel. *All tasks above are subject to change, addition, removal, or modification on an ongoing basis according to state regulations, Medical Assistant Certification Examination requirements, and ABHES guidelines. MAProgramDelivery TheMedicalAssistantProgramisblendedwithresidentialandonlinecoursesandlabs,includinghands-on demonstrations. Lecture and practical skills include but are not limited to PowerPoint presentations, group discussions, audiovisual presentations, visible body animations, clicker technology for remediation and testing, video presentations, demonstrations, skill practices, and return demonstrations. VOCATIONALNURSEPROGRAM(VN) 229

52WEEKS 1570CLOCKHOURS 92.5 QUARTERCREDITHOURS DIPLOMAPROGRAM,4MODULES STANDARDOCCUPATIONALCLASSIFICATION (SOCCode):29-2061.00. POTENTIAL OCCUPATION: Please see a school official for the completelist of potential occupations. LOCATIONS:Concord,Fresno,Modesto,Sacramento,andSanJose DELIVERY:Blended(ResidentialandDistanceEducation) AGurnickAcademyofMedicalArtsstudentintheNursingSkillsLabattheSacramentocampus. VNProgramMission Gurnick Academy and our Vocational Nurse Program faculty are dedicated to providing qualified individuals with an optimal learning experience to provide the healthcare community with competent vocational nursing professionals. They will demonstrate the highest standards of ethics, professionalism, clinical competency, and critical thinking while providing compassionate and respectful patient care. VNProgramDescription The Vocational Nurse program (VN) utilizes the plan that nursing courses progress along the simple to complex continuum. The organizing principle is homeostasis as it relates to the study of representative client problems by addressing the various anatomical systems and specialty areas in nursing. The program includes didactic and laboratory training and a clinical component correlating with theoretical knowledge. As a result of preparation, students can work as Vocational Nurses in hospitals or medical clinics. VNProgramGoalsandObjectives ● Incorporate nursing, behavioral, and physical sciences principles to provide competent care to clients of different ages with different biopsychosocial needs. ● Apply knowledge of specific disease conditions in the prevention, treatment, nursing care, and rehabilitation of clients. ● Differentiate the role of the Vocational Nurse within the medical team. ● Adhere to professional standards incorporating a Vocational Nurse’s legal and ethical responsibilities. ● Utilize critical thinking in assessing, planning, intervening, and evaluating client care within the scopeofVocationalNursepractice. ● Organize,prioritize, and delegate care, communicating effectively with medical team members. VNProgramOutline Table 73. VN Program Course Outline Course Clock Quarter Title Number Hours Credit Hours VN100 FundamentalofNursing* 96.0 9.5 VN110 AnatomyandPhysiology 56.0 5.5 VN120 Clinical Nutrition 32.0 3.0 VN130 Clinical Lab I* 120.0 6.0 VN200 Medical/Surgical Nursing I* 88.0 8.5 VN210 PharmacologyI 40.0 4.0 230

VN220 Clinical II* 278.0 9.0 VN300 Medical/Surgical Nursing II* 96.0 9.5 VN310 PharmacologyII 48.0 4.5 VN320 Clinical III* 278.0 9.0 VN400 Obstetric Nursing 44.0 4.0 VN410 Pediatric Nursing 44.0 4.0 VN420 Psychiatric Nursing 32.0 3.0 VN430 Clinical IV 278.0 9.0 VN440 Preparation for NCLEX 40.0 4.0 TOTAL 1,570.0 92.5 *Paired course. See the course description for more details. VNProgramInformation,Length,andSchedule The program information, length, and schedule may change. Read the accompanying Addendum for changes andupdates,andconnectwithanAdmissionAdvisorfordetails. The Vocational Nurse Program is a diploma program providing a library and classrooms with audiovisual teaching aids, textbooks, journals, anatomical charts, and models. The Instructor-to-Student ratio is 1:15 in the laboratory and clinical externships, 1:30-50 during residential lectures, and 1:25 during online lectures. Classes begin twice a year on the San Jose campus. Classes begin four (4) times yearly on the Concord, Fresno, and Modesto campuses. Students spend 30 to 40 hours per week attending classes, and the program consists of four (4) modules. ModuleOne–MondaythroughFriday Morning Group students must be available from 9:00 AM to 2:00 PM for the lectures/internal clinical experience – four (4) days a week and 6:00 AM to 2:00 PM, or 6:30 AM to 2:30 PM for the clinical skill lab – one (1) day a week depending on the campus. Evening Group students must be available from 5:00 PM to 10:00 PM for the lectures/internal clinical experience – four (4) days a week and from 2:00 PM to 10:00 PM, 2:30 PM to 10:30 PM, or from 3:00 PM to 11:00 PM for the clinical lab – one (1) day a week. (Modesto campus is from 2:30 PM to 10:30 PM). The listed times are approximate. ModuleTwo,Three,andFour–MondaythroughFriday Morning Group students must be available from 9:00 AM to 2:00 PM for the lectures/internal clinical experience – three (3) days a week. Evening Group students must be available from 5:00 PM to 10:00 PM for thelectures/internal clinical experience – three (3) days a week. Morning and Evening Groups students must be available two to five (2 – 5) days per week for the clinical rotations. Regular clinical rotations are 6:00 AM to 3:00 PM and 2:30 PM to 11:30 PM. Particular clinical rotations (Ex. OB, Peds, etc.) might require an alternative schedule (Ex. 8:00 AM to 6:00 PM, Saturdays, etc.). Students must complete those particular rotations according to the schedule provided. For the program’s last four (4) weeks, students will attend a Preparation for NCLEX course – Monday through Friday. 231

Morning Group students must be available from 9:00 AM to 2:00 PM. Evening Group students must be available from 5:00 PM to 10:00 PM. Students receive 616 didactic and laboratory instruction hours and 954 clinical education hours, allowing them to apply the lecture topics to practical use. The curriculum provides students with the technical, clinical, and interpersonal skills necessary to succeed in this challenging field. The expected completion time for this program is 52 weeks, excluding holidays and vacation times. Preparation for NCLEX is provided during the final program module. Students are permitted up to two (2) attempts to pass the exit exam for graduation based on the guidelines in VN440. The first attempt is given after program completion. The second attempt is given two (2) weeks after program completion. Under extraordinary circumstances, applicable Students may be eligible for one (1) additional attempt. See the Student Grievance and Appeals Policy for more information. Class times can and may be rescheduled on an alternate day of the week (Sunday through Saturday) to ensure on-timeprogramcompletionandfulfillmentofrequiredprogramhours. Datesmayvarybycampuslocation.PleaserefertotheAcademicCalendarformoredetails. X-RAYTECHNICIANWITHMEDICALASSISTANTSKILLS(XTMAS) 52WEEKS 1,341CLOCKHOURS 77.5 QUARTERCREDITHOURS DIPLOMAPROGRAM STANDARDOCCUPATIONCLASSIFICATION (SOCCODE):29-2034.00,31-9092.00 POTENTIAL OCCUPATIONS: Pleaseseeaschoolofficialforthe completelist of potential occupations. LOCATIONS:Concord,Sacramento,andVanNuys DELIVERY:Blended(ResidentialandDistanceEducation) Gurnick AcademyofMedicalArtsstudentsintheclassroomattheVanNuyscampus. X-ray Technician with Medical Assistant Skills Program Mission Gurnick Academy of Medical Arts aims to offer quality allied health and nursing programs that integrate professional skills, career-focused education, and hands-on practical experience by empowering students to developandachievetheirpersonalandcareergoals. X-ray Technician with Medical Assistant Skills Program Description The X-ray Technician with Medical Assistant Skills program prepares competent imaging professionals committed to professionalism, ethical behavior, technical knowledge, radiation protection, and patient care. Students who complete this program may pursue an entry-level position as an X-ray Technician in physician’s offices, chiropractic clinics, imaging centers, industrial health, government agencies, and urgent care centers. Graduates who complete the program must passtheCaliforniaStateExaminationtosecureanX-rayTechnician position. Duties may include patient assessment, patient care, vital signs, and x-ray examination of the chest, upperandlowerextremities,andtorsoskeletalbodyparts. X-ray Technician with Medical Assistant Skills Program Goals and Objectives 232

● Graduatestudentswiththeclinicalcompetencerequiredtobeentry-leveltechnologists. ● Produce students who will demonstrate effective interpersonal skills with the entire healthcare teamandthepublic. ● Enable students to employ appropriate critical thinking and problem-solving skills to be entry-level technologists in the clinical setting. X-ray Technician with Medical Assistant Skills Program Student Learning Outcomes ● Demonstratethepositioningskillsofanentry-leveltechnologist. ● Evaluateimagesfordiagnosticquality. ● Employeffectivecommunicationskillswiththehealthcareteam. ● Exhibitcommunicationskillswiththepatientsandthepublic. ● Abilitytoadapttopatients’conditionsthatdeviatefromroutineexams. ● UtilizepropersafetyandALARApracticesforroutineandnon-routineexams. X-ray Technician with Medical Assistant Skills Program Outline Table 74. X-ray Technician with Medical Assistant Skills Program Outline COURSE CLOCK QUARTERCREDIT COURSETITLE NUMBER HOURS HOURS MXT96 MedicalTerminology 28.0 2.0 MXT97 BackOfficeClinical Foundations 68.0 4.5 GE011 AnatomyandPhysiologyI 56.0 5.5 MXT98 BackOfficeClinical Skills 68.0 4.5 MXT99 BackOfficeClinical Laboratory 68.0 4.5 XT111 Radiographic Patient Care 42.0 4.0 XT112 Radiation Physics and Exposure 58.0 5.0 XT113 Radiographic Procedures I 48.0 4.5 XT113L Radiographic Procedures I 30.0 1.5 XT121 Radiation Protection and Biology 70.0 6.0 XT122 Digital Imaging 52.0 4.5 XT123 Radiographic Procedures II 48.0 4.5 XT123L Radiographic Procedures II Lab 30.0 1.5 XT124 Integration of Theory and Practice 25.0 1.0 XT110C Clinical Practice I 160.0 5.0 XT120C Clinical Practice II 160.0 5.0 XT130C Clinical Practice III 160.0 5.0 XT140C Clinical Practice IV 120.0 4.0 XT150 RadiographySeminar 50.0 5.0 TOTAL 1,341.0 77.5 X-ray Technician with Medical Assistant Skills Program Information, Length, and Schedule The program information, length, and schedule may change. Read the accompanying Addendum for changes andupdates,andconnectwithanAdmissionAdvisorformoredetails. 233

The X-ray Technician with Medical Assistant Skills program provides a library and classrooms with teaching aids, textbooks, journals, periodicals, anatomical charts, phantoms, and energized lab equipment. The X-ray Technician with Medical Assistant Skills program is a diploma program. The student will receive didactic, laboratory, and clinical experience in affiliated medical facilities. The Instructor-to-Student ratio is 1:10 for the laboratory, 1:30 during residential lectures, 1:25 during online lectures, and 1:1 during clinical externships. Classes may be scheduled MondaythroughSunday.Studentswillattendupto40hoursperweekofinstruction, including didactic, labs, and clinical. Clinical activities may be held during weekdays or weekends, and shifts may include day or evening as the clinical site requires. Didactic courses are held between 8:00 AM to 10:30 PM. The program’s affiliated clinical sites hold current state-issued certificates as approved clinical sites. The clinical sites provide supervised clinical instruction in the patient care setting. All clinical sites employ radiologic technologists and supervisors/operators (doctors) who hold certification from the State of California Radiologic Health Branch. The X-ray Technician with Medical Assistant Skills program consists of 77.5 quarter credit hours, completed over 52 weeks for 1,341 contact hours. Day/evening classes are currently scheduled for the program. Please refer to thecourseschedulefordetails.Beforegraduation,studentsmustcompletealldidacticandclinicalhours. CONTINUINGEDUCATIONANDONLINEPREREQUISITECOURSES ONLINEEDUCATIONPREREQUISITECOURSES Gurnick Academy of Medical Arts offers Prerequisite Courses that ABHES does not accredit. Prerequisite courses are offered in online and residential formats. Our online education extends prerequisite and supplementalcoursesandisintendedforstudentsenteringourcoreprograms. CONTINUINGEDUCATIONCOURSES Gurnick Academy of Medical Arts offers Continuing Education Courses. These courses are not accredited and are intended to bring professionals up to date in knowledge and skills. CPRCourseforBasicLifeSupport 1DAY 4.5 CLOCKHOURS(FullCourse) 3CLOCKHOURS(RenewalCourse) CPRCard LOCATION:AllCampuses DELIVERY:Residential AGurnickAcademystudent. CPRCourseRegistration Before registration, applicants must meet the following admission criteria: ● ProvideavalidPhotoIdentificationonthedayofthecourse. 234

Applicants must register online through our website. To complete registration, applicants must select the CPR Course on the CE Courses page. Choose an appropriate campus and desired start date and click the Registration button. Follow the required steps to complete registration. Students must contact their Admission Advisor to follow up on the completion of registration. CPRCourseDescription The CPR for Basic Life Support Course aims to train participants to save the lives of victims in cardiac arrest through high-quality cardiopulmonary resuscitation (CPR). The American Heart Association designed the CPR for Basic Life Support Course to prepare healthcare professionals to perform CPR in and out of hospital settings. This course trains participants to promptly recognize cardiac arrest, give high-quality chest compressions, deliver appropriate ventilations, and provide early use of an automated external defibrillator (AED) as part of a team and individually. The course also teaches how to relieve choking. This course includes adult, child, and infant rescue techniques. IntendedAudience This course is intended for medical or nursing students, aides, medical assistants, and other healthcare personnel. CourseLength Thefull course is approximately 4.5 hours. The renewal course is approximately three (3) hours. CPRCardInformation Students who pass the test will receive the BLS/CPR card valid for two (2) years upon class completion. Students whodonotpassthetestwillnotreceivethecard. Diagnostic Medical Imaging Advanced Clinical Practicum 45CLOCKHOURS LOCATION:ConcordCampus DELIVERY:Residential CourseDescription This course allows students to perform clinical repetitions in advanced imaging modalities, including MRI, CT, or Mammography. Repetitionswillbedirectlyrelatedtopost-primarycertification exam requirements. This course canberepeatedamaximumofthree(3)times. CourseObjectives Bythecourseend,studentswillhavebasicknowledgeandunderstandingofthefollowing: 1. Perform clinical repetitions in advanced medical imaging procedures to meet the ARRT® post-primary certification requirements. 2. Practice correct clinical protocols of advanced medical imaging procedures as designated by the clinical site. 3. Exemplify professionalism and follow all related clinical policies and procedures. 4. Provide adequate patient care and demonstrate proper teamwork to healthcare staff. 5. Demonstrateproperbodymechanicswhenprovidingpatientcare. Learning Outcomes 1. Operatewithintheparametersestablishedbytheclinicalevaluationtoolsandtheirobjectives. 2. Complete the minimum number of mandatory clinical repetitions as needed to be eligible to sit for thepost-primarycertification exam requirements. 235

3. Performtheminimumnumberofclinicalhoursrequiredforthecourse. 4. Maintainasafeworkenvironmentforpatients,visitors,andhealthcareworkers. 5. Provide patient-centered, clinically effective care for all patients regardless of age, gender, disability, special needs, ethnicity, or culture. 6. Applystandardandtransmission-basedprecautions. 7. Maintainpatientconfidentiality standards and meet HIPAA requirements. 8. Demonstratetheprinciplesoftransferring, positioning, and immobilizing patients. 9. Communicateprofessionallywiththepatientandstaffmembers 10. Execute imaging protocols according to site standards. Table 75. Diagnostic Medical Imaging Advanced Clinical Practicum Course Outline CourseNumber Title Clock Hours DMI670C AdvancedClinical Practicum 45.0 TOTAL 45.0 Essential Medical Bioscience (EMB) 80CLOCKHOURS LOCATION:Concord,Fresno,Modesto,andSanJose DELIVERY:Residential CourseDescription The Essential Medical Bioscience Course considers the basics of general and human biology. We will examine molecular and cell biology, human anatomy, microbiology, nutrition, and biochemistry topics while incorporating basic medical terminology and reviewing basic math skills in preparing for drug calculations. This is a prerequisite course for entering professional Gurnick Academy of Medical Arts education programs. This course will include a Medical Terminology component, offered in an independent, self-study format that students complete online at their own pace. Students will access moodle.gurnick.edu and select the course Medical Terminology Part 1A. (The instructor will explain specific directions for accessing the material.) Students will be responsible for learning the material presented in this part of the course by completing practice quizzes, games, etc. The material covered in the Medical Terminology Self-Study Course will be evaluated as part of the Final Exam at the end of the Essential Medical Bioscience course. This course does not fall within the ABHES scope of accreditation. CourseGoalsandObjectives ● Structureofatoms,molecules,basicLawsofThermodynamics,propertiesofmatter. ● OrganicChemistryandBiochemistry. ● CellAnatomy,Chemistry,Biochemistry,EnergyMetabolism,celldivision,andcellcycle. ● HumanBodyOrganization,BodyCavities,andMajorOrganSystems. ● BodyTissuesandBasicStructuresandFunctionsofOrgansandOrganSystems. ● BasicconceptsofGeneticsandlawsofinheritance,sexualandasexualreproduction. ● CoreconceptsinMicrobiologyandthestudyofmicrobes. ● BasicsofImmunologyandBloodcompositionandfunctions. ● BasicMedicalTerminologyandcommonacronymsareusedinmostclinicalsettings. ● ElementaryMathskills. 236

CourseOutcomes Uponcoursecompletion,thestudentwillbeableto: ● RetainbasicknowledgeofthecourseobjectivesinHumanBiologyandMedicalScience. ● Classifyvarioustypesofdisordersanddisease-producingorganisms. ● Recognizeandmemorizebasicmedicalterminologyusedinmostclinicalsettings. ● Definecommonacronymsinbasicmedicaltermsusedinmostclinicalsettings. ● Identifymajororgansystemsbyorgansandtheirprimaryfunctions. ● ExplainanddiscussNutritionLabels/CaloricValue/BalancedDietBreakdown. ● Demonstrate the ability to solve fundamental math problems utilizing manipulation of decimals, fractions, and percentages. ● Calculateconversionsbetweenthemetricandhouseholdsystemsusingratioandproportion. ● Measuremedicationadministrationdosesusingratioandproportionsmethodsandsolve. ● Distinguishbetweenapothecaryandhouseholdsystems. ● Reviewandassessindividuallearningchallengesbasedonquizscoresandexams. CourseOutline Table 76. Essential Medical Bioscience Course Outline CourseNumber Title Clock Hours EMB001 Essential Medical Bioscience 80.0 TOTAL 80.0 IV Therapy/BloodWithdrawalCourse 36CLOCKHOURS COURSECOMPLETIONCERTIFICATE/CONTINUING EDUCATIONCERTIFICATE LOCATION:SanJose,Concord,Fresno,Modesto,and Sacramento DELIVERY:Residential Gurnick AcademyofMedicalArtsstudentsintheMedicalAssistantSkillsLabattheModestocampus. Registration Before registration, applicants must meet the following admission criteria: 1. Provide a valid Photo Identification 2. Provide proof of one of the following: ● AcurrentandvalidCaliforniaLVNlicense ● Senior standing in a California Vocational Nurse Program with successful completion of ModuleIV ● GraduatefromaCaliforniaVocationalNurseprogram ● InterimPermitstatusforCaliforniaLVNlicensure ● RNLicensefromtheStateofCalifornia ● PhysicianLicensefromtheStateofCalifornia Applicants must register online through our website. To complete registration, the applicant must select the IV 237

Therapy/Blood Withdrawal Course on the CE Courses page. Choose an appropriate campus and desired start date and click the Registration button. Follow the required steps to complete registration. Applicants must contact their preferred campus Admission Advisor to follow up on the completion of registration. CourseInformationandSchedule The IV Therapy/Blood Withdrawal Certification Course at Gurnick Academy of Medical Arts can be used for the continuing education requirement. The course enhances the knowledge of vocational nurses at a level above that required for licensure. The IV Therapy/Blood Withdrawal course provides a library and classrooms with audiovisual teaching aids, textbooks, journals, anatomical charts, and models. The Instructor-to-Participant ratio in the IV Therapy/Blood Withdrawal course is 1:15 during lectures and clinical practicum. The course is three (3) days of nine (9) hours of didactic training on the theory behind the practice and principles of intravenous therapy and blood withdrawal within the scope of practice for LVNs, RNs, and licensed physicians in the state of California, and one (1) nine (9) hour day of clinical practicum in the clinical skills lab setting in which each student must complete a minimum of three (3) supervised successful venipunctures, and three (3) supervised skin punctures (capillary blood withdrawal) on live human subjects. Theexpectedcoursecompletiontimeisperthecampusschedule. CourseGoalsandObjectives ● Recognize the role of the Registered Nurse and the Licensed Vocational Nurse in IV Therapy and BloodWithdrawal. ● ListfactorsthataffecttheflowratesofIVsolutions. ● DescribetheproperuseofspecificIVtherapy,arterialpuncture,andbloodwithdrawalequipment. ● Initiate IV therapy, blood withdrawal, and arterial puncture utilizing nursing precautions or patient safety by: o Bracingthepatientpsychologically. o Explainingtherationaleforbloodwithdrawal,arterialpunctures,andvenipunctures. o Differentiating between the types of skin puncture, venipunctures, and arterial devices and their appropriate uses. o Discerningbetweenskinpunctures,arterialpunctures,andvenipunctures. o Distinguishingbetweentypesofintravenoussolutionsandtheirappropriateness. o Preparingequipmentproperlyandaseptically. o Selecting and correctly preparing the most appropriate vein for venipunctures, blood withdrawal, or arterial puncture. o Readyingthesiteinamannerthatreducesthechanceofinfection. o Administeringvenipuncturesutilizing direct or indirect methods. o Executing blood withdrawal using skin puncture (vacutainer, butterfly, syringe), arterial puncture, or venipunctures. o Dressingsiteperpolicy. o Securingandimmobilizingthedeviceappropriatelyandsafely. o Regulatingflowrateandfluidaccurately. o Documentingonthemedicalrecord. ● Recognizecomplicationsrelatedtobloodwithdrawal,arterialpunctures,andvenipunctures. ● Recognizelocalandsystemicreactionsassociatedwithintravenoustherapy. ● Listthenursingmeasurestakentoreducelocalandsystemicreactions. 238

● EnumeratefivereasonstodiscontinueandrestarttheIVdevice. ● Statethecauseanddifferentiateclinicalsymptomsofhypovolemiaandhypervolemia. ● Specifythecauseanddifferentiateclinicalsymptomsofelectrolyteimbalances. ● IdentifytheroleofIVtherapyandpHbalance. ● ExpoundonthecausesofpHimbalances. ● Differentiate actions, dosages, side effects, and nursing implications of specified intravenous solutions. ● CorrelatetheIVfluidcontainerlabelwiththesolution’snameascommonlyordered. ● NamethestandardcomponentsofTotalParenteralNutrition(TPN). ● IdentifynursingprecautionsrelatingtoTPN. ● Recognizesafetytechniquesutilizedinbloodtransfusions. ● Recognizetypesoftransfusionreactions. ● Listthenursingactionstakenwhenabloodtransfusionoccurs. ● ExaminethedifferencesbetweenmethodsusedinadultandpediatricIVtherapy. ● DiscusssituationsrelatedtoIVtherapyandlegalimplications. ● DescribeappropriatewaysofminimizinglegalrisksinIVtherapyandbloodwithdrawalpractice. ● Identify the safety precautions concerning administering IV fluids, withdrawing blood, and testing for adequate circulation at the arterial puncture site. CourseOutcomes Uponcoursecompletion,thestudentwillbeableto: ● Discussthestructureandfunctionofveins ● Identify the names and locations of the veins most suitable for phlebotomy and cannulation/venipuncture. ● Assemble equipment and supplies needed to collect blood and for cannulation/venipuncture, and discuss the correct use of each. ● Demonstratethestepsinperformingbloodcollectionandcannulation/venipunctureprocedures. ● Assess techniques and equipment to minimize biohazard exposure in blood collection and cannulation/venipuncture. ● Evaluate procedural blood collection and cannulation/venipuncture errors and discuss remedies for each. ● Differentiate complications associated with blood collection and cannulation/venipuncture and their effect on the quality of laboratory results. Certification Information To complete the clinical portion of the course, all participants must bring a volunteer to participate in the venipuncture and skin puncture skills check-off on the final day. Gurnick Academy of Medical Arts provides two certificate types to its IV Therapy/Blood Withdrawal Course graduates: Course Completion Certificate and Continuing Education Certificate. Please see below for more details regarding certificate applicability. CourseCompletionCertificate LVNs At course completion, the LVN who completes the course will receive a certificate of completion. The certificate will include the course title, completion date, licensee’s name, address, telephone number, license number, and provider code issued by the board. The licensee is advised to retain the certificate in a secure location. After course completion, a copy of the certificate will be submitted to the board, and the licensee will be listed as certified in intravenous therapy and blood withdrawal. 239

Non-LicensedVNs Senior students in good academic standing may also complete the course. However, once senior students complete the course, their Certificate of Completion will not be forwarded to BVNPT until they receive their license. Upon receipt of licensure, the student must contact Gurnick Academy of Medical Arts and request submissionoftherequiredcertificate to the Board. Continuing Education Certificate RNsorLicensedPhysicians These students complete the IV/BW course provided by Gurnick Academy of Medical Arts as a Continuing Education course. The students should receive Continuing Education Certificates, including Gurnick Academy of MedicalArts’ continuing education course approval number. CourseOutline Table 77. Course Outline CourseNumber Title Clock Hours Intravenous Therapy/Blood Withdrawal Certification For Licensed VN500 36.0 Vocational Nurses TOTAL 36.0 International Nurse Graduate Courses (ING) Gurnick Academy of Medical Arts recognizes the contribution of international nurses to the nursing profession. Gurnick Academy of Medical Arts has developed a program for international nurse graduates seeking to completetheareasofdeficienciesidentified by the California State Board of Registered Nursing. Courses in medical-surgical nursing, maternal and newborn, pediatric nursing, and mental health nursing are offered for international nurse graduates who must complete the necessary coursework to be eligible to apply for a California National Council Licensure Examination. The courses provide a comprehensive introduction to nursing practice and the healthcare system in the United States. CourseGoalsandObjectives RN180NursingTransitionAdvancedPlacementTheoryandLabCourse(47clockhours= 3SemesterUnits Theory, 68 clock hours = 2 Semester Units Lab 1. Characterize the various roles of the registered nurse in the healthcare delivery system. 2. Identify the evolving practice opportunities for nurses in various practice settings. 3. Appreciate the characteristics of the nursing profession. 4. Differentiate between licensed practical/vocational nurses and registered nurses. 5. Explain the nursing responsibilities related to the legal and ethical aspects of the profession, delegation, and confidentiality. 6. Detail conceptual and philosophical foundations of professional nursing practice. 7. Define evidence-based practice. 8. Explain the purpose and phases of the nursing process. 9. Specify clinical judgment in nursing practice. 10. Examinefactors creating successful or unsuccessful communication. 11. Evaluate helpful and unhelpful communication techniques. 12. Identify key aspects of collaboration. Skills Lab 240

13. Demonstrate accurate mathematical calculations related to the safe and efficacious administration of fluids and medications. 14. Demonstrateunderstandingandskillsinperforminghealthhistoryandphysicalassessment. 15. Exhibit knowledge and ability to perform basic and complex nursing skills in caring for acute and chronically ill patients utilizing critical thinking skills. 16. Establish accurate documentation related to the assessment and performance of skills. 17. Apply knowledge of theory and principles from nursing and related sciences across the lifespan to selected nursing skills and procedures using the nursing process. RN304Medical/SurgicalIIITheory-AdvancedMed/Surg(3Units,45clockhours) 1. Distinguish specific phenomena for actual or potential patient needs relevant to nursing care of acutely ill and chronically ill adults with respiratory, cardiac, neurological, and musculoskeletal systemdisorders. 2. Identify clinical manifestations, nursing care, and collaborative problems of commonly seen medical or surgical related to respiratory, cardiac, neurological, and musculoskeletal system disorders. 3. Describe the purpose and nursing care of commonly used procedures and interventions in medical or surgical conditions related to respiratory, cardiac, neurological, and musculoskeletal disorders. 4. Employknowledgeofphysicalandbehavioralsciencestodiscernprobableconsequencesofmedical, surgical, and nursing interventions related to respiratory, cardiac, neurological, and musculoskeletal disorders. 5. Implement critical thinking to develop priorities in nursing approaches to patients with various medical or surgical conditions in various states of diagnosis and treatment related to respiratory, cardiac, neurological, and musculoskeletal system disorders. 6. Explain the scientific rationale for selected nursing interventions related to respiratory, cardiac, neurological, and musculoskeletal disorders. RN305Medical/SurgicalIIIClinical-AdvancedMed/Surg(2Units,90clockhours) 1. Communicatetherapeuticallywithindividualsandfamiliesexperiencingadvancedhealthdisruptions related to chronic respiratory, cardiac, neurology, and musculoskeletal system disorders. 2. Plan and implementindividualized patient care using the nursing process. 3. Provide nursing care to adults with advanced medical, surgical, and nursing diagnoses. 4. Afford scientific or empirical rationale for all nursing actions related to chronic respiratory, cardiac, neurology, and musculoskeletal system disorders. 5. Demonstrateincreasingproficiency and autonomywithselectedpsychomotorskills. 6. Establish theory-based interventions with increasing proficiency in patient care management. 7. Collaborate with other healthcare providers to deliver safe, high-quality nursing care. 8. Epitomize accountability and responsibility for your learning experiences and performance. 9. Applylegal and ethical standards in the delivery of nursing care. 10. Demonstrateinitiative in the pursuit and selection of learning activities. 11. Apply personal philosophy of nursing and approach to patient care. 12. Exhibit increased integration of knowledge from courses in previous semesters. 13. Effectively communicate verbally and in writing with patients, families, and healthcare providers to promotehealthandhealing. 14. Utilize current research and evidence-based practice in the clinical setting. 15. Exemplify professional leadership behaviors, including advocacy, delegation, resource utilization, and collaboration with other healthcare providers. RN402Medical/SurgicalIVTheory-ComplexMed/Surg&Leadership(3Units,45clockhours) 1. Identify specific phenomena and actual or potential patient needs relevant to the nursing care of adults with multiple health disruptions. 2. Describe clinical manifestations, nursing care, and collaborative problems of complex medical or surgical conditions in adult populations. 241

3. Apply critical thinking and develop priority in nursing approaches to patients with complex medical or surgical conditions in various states of diagnosis and treatment. 4. Explain the scientific rationale for selected nursing interventions. 5. Determinetheimportanceofnursingleadershipinthehealthcaresystem 6. Critically examine selected nursing practices: a. Adaptnursingpracticestotheageanddevelopmentalstageoftheadult. b. Relate selected nursing research findings to the nursing care of individual clients. c. Analyze alternative nursing actions. RN403Medical/SurgicalIVClinical-ComplexMed/Surg&Leadership(2Units,90clockhours) 1. Communicate therapeutically with individuals and families who are experiencing complex health disruptions. 2. Plan and implementindividualized patient care using the nursing process. 3. Provide nursing care to adults with complex medical, surgical, and nursing diagnoses. 4. Indicate scientific or empirical rationale for all nursing actions. 5. Exhibit increasing proficiency and autonomy with selected psychomotor skills. 6. Demonstratetheory-basedinterventionswithincreasingproficiencyinpatientcaremanagement. 7. Collaborate with other healthcare providers to deliver safe, high-quality nursing care. 8. Exemplify accountability and responsibility for your learning experiences and performance. 9. Applylegal and ethical standards in the delivery of nursing care. 10. Exemplify initiative in the pursuit and selection of learning activities. 11. Implementapersonalphilosophyofnursingandapproachtopatientcare. 12. Implementincreasedknowledgeintegrationfromprevioussemesters’courses. 13. Effectively communicate verbally and in writing with patients, families, and healthcare providers to promotehealthandhealing. 14. Utilize current research and evidence-based practice in the clinical setting. 15. Embody professional leadership behaviors, including advocacy, delegation, resource utilization, & collaboration with other healthcare providers. RN300MaternalNewbornTheory(3Units,45clockhours) 1. Distinguish expected physiological and psychosocial changes during pregnancy, childbirth, and postpartum. 2. Describe typical fetal and infant growth and development from conception to one (1) month of age. 3. Identify basic nursing assessments to be made under the following circumstances: ● Thepregnantwomanduringeachtrimesterofpregnancy. ● Theintrapartumwomanduringthethreestagesoflabor. ● Thepostpartumwomanfromchildbirthtosix(6)weekspostpartum. ● Thefetusduringpregnancyanddelivery. ● Thenewbornfrombirthtoone(1)monthofage. ● The father and siblings of the infant during pregnancy, childbirth, and the postpartum period. 4. Examine common client problems (nursing assessment and collaborative problems) during pregnancy, childbirth, and postpartum. 5. State major learning needs and teaching strategies for educating women and their families during pregnancy, childbirth, and postpartum. 6. Describe selected complications during pregnancy, childbirth, and postpartum. Identify critical nursing assessments and interventions for preventing, detecting, and treating complications. 7. Determine critical nursing assessments and interventions for detecting and preventing newborn complications. 242

RN301MaternalNewbornClinical(1.5Units,67.5clockhours) 1. Execute complete assessments (and written documentation) of the average newborn, correctly identifying (a) normal and abnormal characteristics and (b) relevant nursing diagnoses and collaborative problems. 2. Finish complete assessments (and written documentation) of the postpartum woman, correctly identifying (a) normal and abnormal findings and (b) relevant nursing diagnoses and collaborative problems. 3. Participates in assessing antepartum and laboring women, correctly identifying (a) normal and abnormalfindingsand(b)relevantnursingdiagnosesandcollaborativeproblems. 4. Assess the psychosocial and learning needs of childbearing women and family members (fathers or significant others and siblings) during pregnancy, childbirth, and postpartum. 5. Assess parent/caretaker coping behaviors and strengths. 6. Nursing assessment and diagnosis implement appropriate nursing interventions to promote growth, development,andpositivehealthoutcomesforwomen,theirinfants,andotherfamilymembers. 7. Implement appropriate teaching strategies and evaluate learning outcomes for childbearing women andtheirfamilies. 8. Participate in coaching and comfort measures for women and significant others during labor and birth. 9. Anticipate potential common complications in the childbearing woman and newborn infant by implementingappropriatepreventivemeasuresandassessmentsforearlydetection. 10. Apply selected research findings and evidence-based practices to the nursing care of childbearing women,infants,andotherfamilymembers. 11. Demonstrate caring behaviors and effective communication with maternity clients, families, and health team members. 12. Identify common ethical dilemmas and legal issues in maternity nursing. 13. Demonstrateprofessional behavior. RN302CareofChildrenTheory(3Units,45clockhours) 1. Identify the stressors of childhood which are life-threatening or cause significant disruption in child development,health,andwell-being. 2. Describe the influences of health disruption factors on the developmental process of infants and children. 3. Explore the biopsychosocial, cultural, and developmental effects of selected major health disruptions for children and their families. 4. Assess the physical characteristics of all systems in infants and children of various ages and evaluate thenormalcyofthesefindings. 5. Analyze selected health disruptions in alterations in affected children and their families. 6. Examineparental,family, and sibling stress when a child experiences substantial health disruptions. 7. Formulatenursingdecisionsbasedonthechild’scondition,age,andlifesituation. 8. Determine therapies, surgeries, and nursing interventions that are lifesaving, restorative, or palliative. 9. Reviewachildandtheirfamily’sability to learn new information involved with optimal adaptation to majorhealthdisruptions. 10. Formulate nursing interventions that encourage optimal adaptation to major health disruptions. RN303CareofChildrenClinical(1.5Units,67.5clockhours) 1. Utilize current theory and evidence-based practice guidelines to analyze, plan, and implement nursing care for infants and children of various ages. 2. Perform and document anongoingassessmentandevaluationofthechildandfamily’sprogressand monitornursingcareeffectiveness. 3. Execute and document complex nursing procedures with infants and children who experience significant health disruptions. 243

4. Teachnewadaptivemeasuresandcounselchildrenandfamiliescopingwithsizablestress. 5. Assess the child’s health disruption parameters regarding the family unit while providing support andinformation. 6. Implement protective interventions and provide age-appropriate nurturance for children and families with considerable health disruptions. 7. Collaborate with professional colleagues and student groups to develop and provide continuity of care. 8. Demonstrateprofessionalbehavior. RN400MentalHealthTheory(2Units,30clockhours) 1. Identify biopsychosocial and cultural factors that influence severe mental illness across life. 2. Examine selected theories and research underlying psychiatric nursing care of the major mental illnesses across the lifespan. 3. Formulate psychiatric nursing interventions that facilitate mental health adaptation appropriate to inpatient and community settings. 4. Describe community resources for nursing referral of individuals and families for mental health maintenance,promotion,andrehabilitation. 5. Explain common uses of psychopharmacology in treating mental illness and organic brain syndromes. 6. Differentiate between effective and non-effective communication patterns. RN401MentalHealthClinical(2Units,90clockhours) 1. Demonstrate caring behaviors and therapeutic communication skills, including empathy and facilitation, with clients and their families experiencing psychosocial stress. 2. Apply biopsychosocial and nursing theories and the nursing process into case management components while caring for consumers of psychiatric-mental health services in acute care and communitysettings. 3. Embody professional behaviors of safety, responsibility and accountability, team membership, appropriate hospital and community behavior, and positive communication with consumers, families, staff, peers, and instructors. 4. Incorporate cultural, developmental, socioeconomic, and other individual client differences (physical and psychological) into the service plan, nursing care plan, client care activities, and development of communityresources. 5. Execute stress and anxiety reduction interventions, recovery, rehabilitation, reintegration, and health education with consumers and caregivers. 6. Practice the select psychiatric-mental health nursing roles, including counselor, collaborator, consultant, teacher, case manager, and direct care provider. International Nurse Graduate Course Outline Table 78. Transition Course Course CourseTitle Clock Hours SemesterCredit Number Hours RN180 Nursing Transition Advanced Placement Theory & Lab 52.5 Theory 3.5 Units Theory Course 67.5 Lab 1.5 Units Lab TOTAL 120.0 5.0 Table 79. Medical-Surgical Nursing 244

Course CourseTitle Clock Hours SemesterCredit Number Hours RN304 Medical/Surgical III Theory-Advanced Med/Surg 45.0 3.0 RN305 Medical/Surgical III Clinical-Advanced Med/Surg 90.0 2.0 RN402 Medical/Surgical IV Theory-Complex/Critical Care 45.0 3.0 Med/Surg&Leadership RN403 Medical/Surgical IV Clinical-Complex/Critical Care 90.0 2.0 Med/Surg&Leadership TOTAL 270.0 10.0 Table 80. MaternalandNewbornNursing Course CourseTitle Clock Hours SemesterCredit Number Hours RN300 MaternalNewbornTheory 45.0 3.0 RN301 MaternalNewbornClinical 67.5 1.5 TOTAL 112.5 4.5 Table 81. CareofChildren Course CourseTitle Clock Hours SemesterCredit Number Hours RN302 CareofChildrenTheory 45.0 3.0 RN303 CareofChildrenClinical 67.5 1.5 TOTAL 112.5 4.5 Table 82. MentalHealthNursing Course CourseTitle Clock Hours SemesterCredit Number Hours RN400 MentalHealthTheory 30.0 2.0 RN401 MentalHealthClinical 90.0 2.0 TOTAL 120.0 4.0 MagneticResonanceImaging(MRI)Intravenous(IV)BloodWithdrawalCourse 12CLOCKHOURS 2-DAYCOURSE|6HOURSPERDAY LOCATION:SanJose DELIVERY:Residential Registration Before registration, applicants must meet the following admission criteria: 1. Provide a valid Photo Identification 245

Applicants must register online through our website. To complete registration, the applicant must first select Magnetic Resonance Imaging IV Injections & Blood Withdrawal Course on the CE Courses page. Choose an appropriate campus and desired start date and click the Registration button. Follow the required steps to complete registration. Applicants must contact the preferred campusAdmissionAdvisortofollowupwithregistrationcompletion. CourseInformation,Length,andSchedule The Magnetic Resonance Imaging IVInjections & Blood Withdrawal Course at Gurnick Academy of Medical Arts canbeusedtoperformIVinjectionsandbloodwithdrawalforMRITechnologistsandstudents. The Magnetic Resonance Imaging IV Injections & Blood Withdrawal Course provides a library and classrooms with audiovisual teaching aids, presentations, and models. The Magnetic ResonanceImagingIVInjections&BloodWithdrawalCourseInstructortoParticipantratiois1:15 in lecture and clinical practicum. The course is two (2) days of three (3) hours of didactic training on the theory behind the practice and principles of intravenous injections and blood withdrawal within the scope of practice for MRI Technologists in the state of California and nine (9) hours of clinical practicum in the clinical skills lab setting. During the clinical practicum, each student must complete a minimum of five (5) supervised successful IV injections and five (5) supervised venipunctures (capillary blood withdrawal) on live human subjects. To complete the clinical portion of the course, all participants must bring a volunteer to participate in the venipuncture and skin puncture skills check-off on Day 2 – the final day. CourseGoalsandObjectives ● RecognizetheroleoftheMRITechnologistsinperformingIVinjectionsandbloodwithdrawals. ● DescribetheproperuseofspecificIVinjectionandbloodwithdrawalequipment. ● Initiate IV injection and blood withdrawal placement utilizing patient safety precautions by ○ Preparingthepatientpsychologically. ○ ExplainingtherationaleforIVinjectionandbloodwithdrawal. ○ Differentiating between the types of IV injection, skin puncture, venipunctures, and their appropriate uses. ○ Distinguishingbetweenskinpuncture,IVInjection,andvenipunctures. ○ Preparingequipmentadequatelyandaseptically. ○ Selecting and correctly preparing the most suitable vein for IV Injection, venipunctures, and bloodwithdrawal. ○ Readyingthesiteinamannerthatreducesthechanceofinfection. ○ Executingbloodwithdrawalutilizingskinpuncture(vacutainer,butterfly) venipunctures. ○ Dressingsiteaccordingtopolicy. ○ Securingandimmobilizingthedeviceappropriatelyandsafely. ○ Documentingonthemedicalrecord. ● RecognizecomplicationsrelatedtoIVInjection,bloodwithdrawal,andvenipunctures. ● Listthemeasurestakentoreducelocalandsystemicreactions. ● StatereasonstodiscontinueandrestarttheIVdevice. ● ExaminethedifferencesbetweenadultandpediatricIVInjectionsandbloodwithdrawaltechniques. ● Discuss legal implications and ways of minimizing legal risk related to IV Injections and blood withdrawal. ● IdentifysafetyprecautionsrelatedtoIVInjectionsandbloodwithdrawal. 246

CourseOutcomes Uponcoursecompletion,thestudentwillbeableto: ● Discussthestructureandfunctionofveins ● Identify the names and locations of the veins most suitable for phlebotomy and cannulation/venipuncture. ● Assemble equipment and supplies needed to collect blood and for cannulation/venipuncture, and discuss the correct use of each. ● Demonstratethestepsinperformingbloodcollectionandcannulation/venipunctureprocedures. ● Assess techniques and equipment to minimize biohazard exposure in blood collection and cannulation/venipuncture. ● Evaluate procedural blood collection and cannulation/venipuncture errors and discuss remedies for each. ● Differentiate complications associated with blood collection and cannulation/venipuncture. Certification Information Students will be issued a Course Completion Certificate at completion. NursingTransition AdvancedPlacementTheory&LabCourse 120CLOCKHOURS LOCATION:ConcordandFresno RESIDENTIAL CourseDescription TheNursingTransitioncourseisanadmissioncourserequiredforallstudentselectingtoenrollintheLVNtoRN AdvancedPlacementandLVNtoBSNAdvancedPlacementprograms.TheadmissioncourseisRN180–Nursing Transition Advanced Placement Theory & Lab Course. It is a five (5) unit, 120-hour course that evaluates the student’s readiness to enroll in the Advanced Placement pathway. The student must demonstrate the required knowledgeandskillstocompletethiscourse.AllstudentsmustcompletethesebeforestartinganyProfessional Courses. This course does not fall within the ABHES scope of accreditation. CourseObjectives After this course, the student will be able to: 1. Illustrate the various roles of the registered nurse in the healthcare delivery system. 2. Identify the evolving practice opportunities for nurses in various practice settings. 3. Exemplify the characteristics of the nursing profession. 4. Differentiate between licensed practical/vocational nurses and registered nurses. 5. Explain the nursing responsibilities related to the legal and ethical aspects of the profession, delegation, and confidentiality. 6. Describe the conceptual and philosophical foundations of professional nursing practice. 7. Define evidence-based practice. 8. Chronicle the purpose and phases of the nursing process. 9. Define clinical judgment in nursing practice. 10. Discuss factors creating successful or unsuccessful communication. 11. Evaluate helpful and unhelpful communication techniques. 12. Identify key aspects of collaboration. 247

13. Exhibit accuracy in mathematical calculations related to safe and efficacious administration of fluids andmedications. 14. Embodyunderstandingandskillsinperforminghealthhistoryandphysicalassessment. 15. Enact a knowledge and ability to perform basic and complex nursing skills in caring for acute and chronically ill patients utilizing critical thinking skills. 16. Execute accurate documentation related to the assessment and performance of skills. 17. Apply knowledge of theory and principles from nursing and related sciences across the lifespan to selected nursing skills and procedures using the nursing process. CourseOutline Table 83. SemesterCredit CourseNumber Title Clock Hours Hours Nursing Transition Advanced Placement RN180 120.0 5.0 Theory&LabCourse TOTAL 120.0 5.0 COURSEDESCRIPTIONS Courses within the programs are not necessarily sequentially offered as they appear in this catalog. Gurnick Academy of Medical Arts reserves the right to change equipment and instructional materials, modify the curriculum, and combine or cancel classes. Orientation–DistanceEducation(Online) SMO001–MoodleReady,Students’BasicMoodleProficiency–Pass/NoPass Prerequisite: None This course familiarizes students with the common aspects of the Gurnick Academy of Medical Arts Moodle Learning ManagementSoftware(LMS)andbetterpreparesthemtosucceed in theiracademic courses. Before starting academic courses, this course and SMO 002: Academic Integrity Workshop course are required. SMO002–AcademicIntegrityWorkshop–Pass/NoPass Prerequisite: None This course covers avoiding plagiarism and prepares students for online activities using Gurnick Academy of MedicalArts’ academic integrity tools. This is a prerequisite course to all academic courses. GECourses–DistanceEducation(Online) GE001–BiologyBasics–45ClockHours/4.5QuarterCreditHours Prerequisite: None This course introduces major biological molecules, cell structure and function for eukaryotic and prokaryotic organisms, cell cycle, genetics, sexual and asexual reproduction, bioenergetics, cell communication, and signaling. This is a General Education Course. GE002–PrinciplesofPhysics–45ClockHours/4.5QuarterCreditHours/3SemesterCreditHours Prerequisites: None This is a conceptual physics course for non-science majors. This course aims to facilitate students’ understanding of the rules of nature by learning the foundations. This course covers forces and motion, 248

conservation laws, heat, fluids, vibrations and waves, electricity and magnetism, sound, and light. Students will study the concepts of physics with minimal application of mathematics. This is a General Education Course. GE003–ConceptualChemistrywithLaboratory–75ClockHours/6QuarterCreditHours Prerequisite: None ConceptualChemistryisanintroductorychemistrycoursedesignedtoshowhowchemistryisintimately involved in many aspects of our lives. The course will cover basic concepts in chemistry and their applications. Thecoursecoversmatterandenergy,atoms,ionsandcompounds,chemicalreactions,electronicstructureof atoms,states of matter including solutions, acids and bases, a brief introduction to nuclear and organic chemistry, and biochemistry. Students will study the concepts of physics with minimal application of mathematics.Thisisachemistrycoursefornon-sciencemajors.ThisisaGeneralEducationCourse. GE011–Anatomy&PhysiologyI–56ClockHours/5.5QuarterCreditHours Prerequisite: None This course covers the structure and function of the human body from the single cell through all body systems. Additionally, the course examines the interrelatedness of the structure and functions in the body. Basic fluid, electrolyte, and acid/base balance concepts are included. This is a General Education Course. GE020A–HumanBodyinHealthandDiseaseIwithLab–75ClockHours)/90BRNClockHours/6Quarter Credit Hours/4 Semester Credit Hours Prerequisite: None This is the first of two courses covering the structure and function of human organ systems. The basics of the structures and functions of the human body will be discussed during the lecture and lab. Between GE 020A and GE020B,topicsonallmajororgansystemswillbeexaminedwhileconsideringtheminthestateofhealth versus the state of disease. This course is the prerequisite for GE 020B – Human Body in Health & Disease II. This is a General Education Course. GE020B–HumanBodyinHealthandDiseaseIIwithLab–75ClockHours)/90BRNClockHours/6Quarter Credit Hours/4 Semester Credit Hours Prerequisite: GE 020A – Human Body in Health and Disease I with Lab. This is the second of two courses covering the structure and function of human organ systems. The basics of the structures and functions of the human body will be discussed during the lecture and lab. Between GE 020A and GE020B,topicsonallmajororgansystemswillbeexaminedwhileconsideringtheminthestateofhealth versus the state of disease. Prerequisite: GE 020A – Human Body in Health and Disease I with Lab. This is a GeneralEducationCourse. GE021–EssentialsofAnatomy&Physiology–66ClockHours/6.5QuarterCreditHours Prerequisites: None This course will discuss the basics of structures and functions of the human body systems. Topics on all major organ systems will be examined while considering them in the state of health versus the state of disease, focusing mainly on structures. Various clinical implications and possible deviations from the norm of each organ systemwill be brought up throughout the course. This is a General Education Course. GE022–Anatomy&PhysiologyII–45ClockHours/3SemesterCreditHours Prerequisite: None This is an advanced course in Anatomy and Physiology, where details of structures and functions of the human bodysystemswillbediscussedinvariousdiseasestates.Thepathophysiologyofallmajororgansystemswillbe addressedwhilecomparingtheminthestateofhealthversusdisease,focusingmainlyonfunctionsand pathological abnormalities. Various clinical implications and possible deviations from the norm of each organ systemwill be brought up throughout the course. This is a General Education course. 249

GE031–NutritioninHealthandDisease–45ClockHours/3SemesterCreditHours Prerequisite: None This course covers the nutrient needs for maintaining a positive nutritional status, including diets to fit specific health needs and primary nutritional care. GE041–GeneralMicrobiologyw/Lab–75ClockHours)/90BRNClockHours/6QuarterCreditHours/4 SemesterCreditHours Prerequisite: None This course presents basic concepts of microbiology and practical applications to medicine, public health, and theenvironment,withlaboratorytechniquesinisolation,enumeration,andidentificationofmicroorganisms. This is a General Education Course. GE103–GrowthandDevelopmentthroughLifespan–45ClockHours/3SemesterCreditHours Prerequisite: None This course discusses the existing growth and development theories. It focuses on understanding the dynamic sequenceofbiological, psychological, and sociological changes that occur through the life cycle from birth to death. This is a General Education Course. GE110–CriticalThinking–45ClockHours/4.5QuarterCreditHours/3SemesterCreditHours Prerequisites: None This course teaches students the skills they need to think for themselves—skills they will call upon in this course, other college courses, and the world that awaits. This course covers the core concepts with real-world examplesandpracticeexercises.ThisisaGeneralEducationCourse. GE111–ResearchStatistics–45ClockHours/3SemesterCreditHours Prerequisite: None This course is preparation for RN 305 – Nursing Research. The course introduces statistical test tools, the conditions under which these tools are used, statistical calculation, and the meaning of statistics. The tools are also discussed as the basis of data analysis, probability, and statistical inference and their importance in decision-making. This is a General Education Course. GE112–AlgebraI–45ClockHours/4.5QuarterCreditHours/3SemesterCreditHours Prerequisites: None This course gives students the math skills that provide a foundation for more advanced courses. Students will explore writing and solving linear and nonlinear equations, powers and exponents, quadratic equations, polynomials and factoring, graphing, and solving linear inequalities and functions. This is a General Education Course. GE112-50–CollegeAlgebra(50hr)–50ClockHours/5QuarterCreditHours Prerequisite: None This course gives students the math skills that provide a foundation for more advanced courses. Students will explore writing and solving linear and nonlinear equations, powers and exponents, quadratic equations, polynomials and factoring, graphing and solving linear inequalities, and functions. Attending a Live Webinar session is a required part of this course. This is a General Education Course. GE120–IntroductiontoInformationSystems–45ClockHours/3SemesterCreditHours Prerequisite: None This course introduces personal computer application software, hardware components, and the Internet. The course covers an introduction to word processing, electronic spreadsheets, databases, and presentation software. This is a General Education Course. GE201–IntroductiontoSociology–45ClockHours/4.5QuarterCreditHours/3SemesterCreditHours 250

Prerequisite: None This course studies basic methods and concepts of sociology, which have broad academic relevance and can be applied to studying sociology and other academic disciplines. This is a General Education Course. GE201-50–IntroductiontoSociology(50hr)–50ClockHours/5QuarterCreditHours Prerequisite: None This course studies basic methods and concepts of sociology, which have broad academic relevance and can be applied to studying sociology and other academic disciplines. Attending a Live Webinar session is a required part of this course. This is a General Education Course. GE202–GeneralPsychology–45ClockHours/3SemesterCreditHours Prerequisite: None This course includes studying basic methods and concepts of psychology, which have broad academic relevance andcanbeappliedtostudyingpsychologyandotheracademicdisciplines.ThisisaGeneralEducationCourse. GE221–WrittenCommunicationforProfessionals–45ClockHours/3SemesterCreditHours Prerequisite: None Theability to write clearly and effectively is key to professional communication. This set of skills should not be limited to journalists or professional authors. This course will discuss overcoming common mistakes and improvingcommunicationusingthewrittenword. This writing skills course includes spelling, grammar, the importance of structure, and formal and informal writing styles. This course also covers the skills needed to enable learning, communication of ideas, and understandingtheideasofothersmoreeffectively.ThisisaGeneralEducationCourse. GE222–EnglishReadingandComposition–45ClockHours/4.5QuarterCreditHours/3SemesterCredit Hours Prerequisite: None This course introduces students to reading various literary texts and teaches them the basic elements of fiction, poetry, and drama. The course will teach students to write analysis, explication, and compare-and-contrast essays responding to the literature read. This is a General Education Course. GE222-50–EnglishReadingandComposition(50hr)–50ClockHours/5QuarterCreditHours Prerequisite: None This course introduces students to reading various literary texts and teaches them the basic elements of fiction, poetry, and drama. The course will teach students to write analysis, explication, and compare-and-contrast essays responding to the literature read. Attending a Live Webinar session is a required part of this course. This is a General Education Course. GE230–Written&OralCommunication–45ClockHours/4.5QuarterCreditHours Prerequisites: None This course will explore the fundamental analog and digital skills of oral and written communication to help create professional written and oral communication within their careers. This is an introduction to various methods used to communicate effectively and create a language that articulates information to connect a speakertoanaudience.ThisisaGeneralEducationCourse. GE240–PublicSpeaking,BasicsofEffectiveCommunication–45ClockHours/3SemesterCreditHours Prerequisite: None This course introduces communication in interpersonal relationships, group interactions, and formal speaking, with skill development in listening, speech preparation, and oral presentation. This is a General Education Course. 251

GEH020–MedicalTerminology–18ClockHours/1.5QuarterCreditHours Prerequisite: None This course introduces the student to medical and pathological terms related to specific body systems. Through lectures, discussions, demonstrations, visual aids, and self-study, the student will develop knowledge and understandingoftheprofessionallanguagetofunctionandcommunicateeffectivelywithothermedicalteam members.ThisisaGeneralEducationCourse. GEH101–OrganizationandFunctionofHealthServices–45ClockHours/3SemesterCreditHours Prerequisite: None This course focuses on healthcare and delivery of services: identification and function of governmental, private, andvoluntaryorganizations and programs in health protection and promotion at local, state, and national levels. This is a General Education Course. GEH102–EssentialsofPatientEducation–45ClockHours/3SemesterCreditHours Prerequisite: None This GE course toward the BSN or bachelor’s degree in imaging disciplines identifies the principles of effective patient education. It explores cultural needs, literacy, and other barriers to understanding and amiability to health education. Students will develop oral and written presentations of culturally sensitive material by the course’s end. This is a General Education Course. GEH201–HolisticHealthandComplementaryAlternativeMedicine–30ClockHours/2SemesterCredit Hours Prerequisite: None This course synthesizes East and West modalities that can be applied to patient care in and out of care facilities. It introduces the holistic concept of health and wellness and adjunctive therapies. Complementary Alternative Medicine(CAM)canbeusedaloneorwithestablishedapproachestomedicalintervention.Thetopics discussed include stress reduction, meditation, relaxation techniques, visual imagery, and herbal therapies. This is a General Education Course. GEH253–EthicsandLawinRadiography–24ClockHours/2QuarterCreditHours Prerequisite: Completion of GEH 020 with a “C” or better. This course provides a fundamental background in ethics. The historical and philosophical basis of ethics and the elements of ethical behavior will be discussed. Students examine various ethical issues and dilemmas they mayfaceinclinical practice. This course will include out-of-class work such as reading and writing assignments, practice and practical application assignments, and projects. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. GEH301–EthicsandLawinHealthScience–45ClockHours/3SemesterCreditHours Prerequisite: None This course examines health law and ethics and their financial and emotional impact on healthcare professionals, patients, and facilities. Course content includes legal and compliance issues affecting both the employeeandemployer.Topicsincludeadministrativelaw,professionalmalpractice,patientrights, risk management,laborlaw,contractlaw,andethicalconsiderations.ThisisaGeneralEducationCourse. Associate of Occupational Science in Cardiac Ultrasound Technology (A.O.S. in CUT) Courses – Blended Program CS300–IntroductiontoCardiology1–72ClockHours/7QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. Introduction to Cardiology 1 is an introduction to anatomy, physiology, diagnostic tests, embryology and 252

development, normal ECG interpretation and physical examination of the heart, and cardiovascular pharmacology. This course establishes foundations for the knowledge necessary to perform adult echocardiogramssuccessfully. CS300L–LaboratoryIntroductiontoCardiology1–72ClockHours/3.5QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. This course will be taught concurrently with CS 300. Laboratory Introduction to Cardiology 1 is concurrent with the lecture portion of the course. Students will practice the protocols and scanning techniques within the lab. This course will set the foundation of protocols that students can build on with advanced techniques and measurements taught in other courses. CS301–IntroductiontoAdultEchocardiography1–72ClockHours/7QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. Adult Echocardiography 1 covers the concepts, techniques, measurements, calculations, and protocols that pertain to a normal adult transthoracic echocardiogram (TTE). This course establishes foundations for performing and interpreting a normal TTE that would be used later to understand abnormalities and diagnose cardiac pathologies. Students will gain an understanding of the role an echocardiographer plays in the diagnosis of cardiac diseases by understanding what the criteria are for “normal.” CS301L–LaboratoryIntroductiontoAdultEchocardiography1–72ClockHours/3.5QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. This course will be taught concurrently with CS 301. Laboratory Adult Echocardiography 1 is concurrent with the lecture portion of the course. Students will practice the protocols, measurements, and scanning techniques within the lab. This course will expand the echocardiographic protocols taught in CS-301L to include all the echocardiographic measurements and more advancedscanningtechniques. CS400–IntroductiontoCardiology2–72ClockHours/7QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. Introduction to Cardiology 2 is a progression of CS 300 Introduction to Cardiology 1. This course builds on the foundations and principles discussed in the previous course. The common disease processes affecting the cardiovascular system will be covered with instructions on their pathophysiology, signs and symptoms, diagnostic tests, physical examination, lab values, and ECG appearance. CS400L–LaboratoryIntroductiontoCardiology2–72ClockHours/3.5QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. This course will be taught concurrently with CS 400. Laboratory Introduction to Cardiology 2 is concurrent with the lecture portion of the course. Students will practice the protocols, measurements, and scanning techniques within the lab. This course will expand the echocardiographic protocols taught in CS-300L and CS 301L to include all the echocardiographic measurements andECGpracticeandintroducevascularprotocols. CS401–IntroductiontoAdultEchocardiography2–72ClockHours/7QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. Adult Echocardiography 2 is a progression of CS 301- Adult Echocardiography 1. This course builds on the foundations set in the previous course regarding echocardiographic protocols and scanning techniques. The common disease processes affecting the cardiovascular system will be covered with an emphasis on their sonographic appearanceandevaluationwithechocardiography. CS401L–LaboratoryIntroductiontoAdultEchocardiography2–72ClockHours/3.5QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. This course is taught concurrently with CS 401. 253

Laboratory Adult Echocardiography 2 is concurrent with the lecture portion of the course. Students will practice the protocols, measurements, and scanning techniques within the lab. This course will expand the echocardiographic protocols taught in CS-300L, CS 301L, and CS 400L to include all the echocardiographic measurementsandECGpracticesandintroducevascularprotocols. CS520A—RegistryPreparationCourse:AnatomyandPhysiology–8ClockHours/0.5QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. Registry Preparation Courses (RPC) are advanced cardiac classes taught by experts in cardiac sonography. Students have learned basic cardiac skills during cardiac sonography courses 1-4 and cardiac sonography Lab courses 1-4. RPC classes will build and enrich knowledge and skills that will provide the student success in Cardiac sonography. Registry Preparation courses are offered once a month for six consecutive months. Please checkwithinstructors for dates. This course provides the learner with an overview of duplex imaging of the extracranial cardiovascular system. Course study includes normal and abnormal cross-section anatomy, hemodynamics, spectral analysis, clinical signs and symptoms, indications for exams, definitions of terms, scanning protocol, instrumentation, sonographic techniques (grayscale conventional, color Doppler, color with spectral Doppler, and power Doppler) and examples of common carotid, vertebral and Subclavian artery pathology. Clinical hands-on training integrated with didactic instruction is the primary focus of this program. CS520B–RegistryPreparationCourse:Pathology1–8ClockHours/0.5QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. Registry Preparation Courses (RPC) are advanced cardiac classes taught by experts in cardiac sonography. Students have learned basic cardiac skills during cardiac sonography courses 1-4 and cardiac sonography Lab courses 1-4. RPC classes will build and enrich knowledge and skills that will provide the student success in Cardiac sonography. Registry Preparation courses are offered once a month for six consecutive months. Please checkwithinstructors for dates. This course provides the learner with an overview of duplex imaging of the extracranial cardiovascular system. Course study includes normal and abnormal cross-section anatomy, hemodynamics, spectral analysis, clinical signs and symptoms, indications for exams, definitions of terms, scanning protocol, instrumentation, sonographic techniques (grayscale conventional, color Doppler, color with spectral Doppler, and power Doppler) and examples of common carotid, vertebral and Subclavian artery pathology. Clinical hands-on training integrated with didactic instruction is the primary focus of this program. CS520C–RegistryPreparationCourse:Pathology2–8ClockHours/0.5QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. Registry Preparation Courses (RPC) are advanced cardiac classes taught by experts in cardiac sonography. Students have learned basic cardiac skills during cardiac sonography courses 1-4 and cardiac sonography Lab courses 1-4. RPC classes will build and enrich knowledge and skills that will provide the student success in Cardiac sonography. Registry Preparation courses are offered once a month for six consecutive months. Please checkwithinstructors for dates. This course provides the learner with an overview of duplex imaging of the extracranial cardiovascular system. Course study includes normal and abnormal cross-section anatomy, hemodynamics, spectral analysis, clinical signs and symptoms, indications for exams, definitions of terms, scanning protocol, instrumentation, sonographic techniques (grayscale conventional, color Doppler, color with spectral Doppler, and power Doppler) and examples of common carotid, vertebral and Subclavian artery pathology. Clinical hands-on training integrated with didactic instruction is the primary focus of this program. CS520D–RegistryPreparationCourse:Pathology3–8ClockHours/0.5QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. 254

Registry Preparation Courses (RPC) are advanced cardiac classes taught by experts in cardiac sonography. Students have learned basic cardiac skills during cardiac sonography courses 1-4 and cardiac sonography Lab courses 1-4. RPC classes will build and enrich knowledge and skills that will provide the student success in Cardiac sonography. Registry Preparation courses are offered once a month for six consecutive months. Please checkwithinstructors for dates. This course provides the learner with an overview of duplex imaging of the extracranial cardiovascular system. Course study includes normal and abnormal cross-section anatomy, hemodynamics, spectral analysis, clinical signs and symptoms, indications for exams, definitions of terms, scanning protocol, instrumentation, sonographic techniques (grayscale conventional, color Doppler, color with spectral Doppler, and power Doppler) and examples of common carotid, vertebral and Subclavian artery pathology. Clinical hands-on training integrated with didactic instruction is the primary focus of this program. CS 520E – Registry Preparation Course: Measurement Techniques and Maneuvers – 8 Clock Hours/0.5 QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. Registry Preparation Courses (RPC) are advanced cardiac classes taught by experts in cardiac sonography. Students have learned basic cardiac skills during cardiac sonography courses 1-4 and cardiac sonography Lab courses 1-4. RPC classes will build and enrich knowledge and skills that will provide the student success in Cardiac sonography. Registry Preparation courses are offered once a month for six consecutive months. Please checkwithinstructors for dates. This course provides the learner with an overview of duplex imaging of the extracranial cardiovascular system. Course study includes normal and abnormal cross-section anatomy, hemodynamics, spectral analysis, clinical signs and symptoms, indications for exams, definitions of terms, scanning protocol, instrumentation, sonographic techniques (grayscale conventional, color Doppler, color with spectral Doppler, and power Doppler) and examples of common carotid, vertebral and Subclavian artery pathology. Clinical hands-on training integrated with didactic instruction is the primary focus of this program. CS 520F – Registry Preparation Course: Clinical Care and Safety, Instrumentation, Optimization, and Contrast –8ClockHours/0.5QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. Registry Preparation Courses (RPC) are advanced cardiac classes taught by experts in cardiac sonography. Students have learned basic cardiac skills during cardiac sonography courses 1-4 and cardiac sonography Lab courses 1-4. RPC classes will build and enrich knowledge and skills that will provide the student success in Cardiac sonography. Registry Preparation courses are offered once a month for six consecutive months. Please checkwithinstructors for dates. This course provides the learner with an overview of duplex imaging of the extracranial cardiovascular system. Course study includes normal and abnormal cross-section anatomy, hemodynamics, spectral analysis, clinical signs and symptoms, indications for exams, definitions of terms, scanning protocol, instrumentation, sonographic techniques (grayscale conventional, color Doppler, color with spectral Doppler, and power Doppler) and examples of common carotid, vertebral and Subclavian artery pathology. Clinical hands-on training integrated with didactic instruction is the primary focus of this program. CSX01–Clinical1–400ClockHours/13QuarterCreditHours Prerequisite: Completion of UT 301, CS 401, CS 401L, CS 400, and CS 402L courses. CS X01 is twelve (12) weeks of Level 1 externship integrated within AOSCUT module courses. Externship expectations will vary as to the externship site assignment for each student. This allows the student to relate theory to practice in a supervised situation. The student’s ability to perform correct protocols and acquire effective patient diagnostic information is evidenced by meeting specific objectives and competencies in each clinical specialty area. 255

Level 1 competency evaluation will be signed off by clinical instructors on Trajecsys and reviewed by the clinical coordinator. A Clinical Instructor (CI) Preceptor Handbook is provided for each site supervisor. The handbook guides the CI and department staff on the expectations of the ultrasound extern. CS XO1 also consists of assignmentsonMoodleforARDMSpreparation. The emphasis will be on the SPI preparation to encourage students in CS XO1 to take the ARDMS SPI exam before graduation. ARDMS preparation in Adult echocardiography is also provided. There are virtual labs on Moodle to be used in case clinical site assignments are unavailable for reasons determined by the clinical site and the school. The clinical coordinator may give virtual lab assignments for extra learning opportunities or make-upassignments. CSX02–Clinical2–400ClockHours/13QuarterCreditHours Prerequisite: Completion of UT 301, CS 401, CS 401L, CS 400, CS 402L, and CS X01 courses. CS X02 is twelve weeks (12) of Level 2 externship integrated within AOSCUT module courses. Externship expectations will vary as to the externship site assignment for each student. This allows the student to relate theory to practice in a supervised situation. The student’s ability to perform correct protocols and acquire effective patient diagnostic information is evidenced by meeting specific objectives and competencies in each clinical specialty area. Level 2 competency evaluation will be signed off by clinical instructors on Trajecsys and reviewed by the clinical coordinator. A Clinical Instructor (CI) Preceptor Handbook is provided for each site supervisor. The handbook guides the CI and department staff on the expectations of the ultrasound extern. CS XO2 also consists of assignmentsonMoodleforARDMSpreparation. The emphasis will be on the SPI preparation to encourage students in CS XO2 to take the ARDMS SPI exam before graduation. ARDMS preparation in Adult echocardiography is also provided. There are virtual labs on Moodle to be used in case clinical site assignments are unavailable for reasons determined by the clinical site and the school. The clinical coordinator may give virtual lab assignments for extra learning opportunities or make-upassignments. Associate of Occupational Science in Respiratory Care (A.O.S. in RC) Courses – Blended Program RC100–RespiratoryCareFundamentalsI–15ClockHours/1SemesterCredit Prerequisite – None This course will provide an introduction to the field of Respiratory Care and its governing bodies. Students will explore the history of respiratory care, the importance of evidence-based practice, quality, patient safety, communication, record keeping, infection prevention and control, ethical and legal implications, and principles of Respiratory Care and Basic Life Support. RC120–MedicalTerminologywithanEmphasisinRespiratoryCare–30ClockHours/2SemesterCredits Prerequisite – None This course will lay the foundation of the language used in the healthcare setting. Students will examine the elements of medical terms and how they apply to anatomy, physiology, procedures, and diagnoses. There will beaconcentratedfocusontheterminologythatisutilizedinthefieldofRespiratoryTherapy. RC200–RespiratoryCareFundamentalsII–75ClockHours/4SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This hybrid course will provide students with a foundation in the many respiratory treatment modalities within the hospital setting. In the classroom, students will explore the topics of airway pharmacology, aerosol drug therapy, bland aerosol therapy, airway clearance therapy, lung expansion therapy, medical gasses and associated therapies, airway management, and emergency response. In the lab setting, students will apply skills learned using high-fidelity simulation. 256

RC 220 – Anatomy and Physiology with an Emphasis on the Cardiopulmonary System – 60 Clock Hours / 4 SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This course details the structure and function of the human body from a systemic approach. There is an in-depth focus on the cardiopulmonary system, cardiopulmonary physiology, and how it contributes to the acid/base balance of the body. RC240–Pharmacology–45ClockHours/3SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This course will provide a history of pharmacology and will focus on medications used in the respiratory care setting and general nursing. Students will be familiarized with the classification of medications, their actions and application, principles and procedures for safe administration, possible side effects and interactions, and computationofadultandpediatricdosing. RC260–PatientAssessmentandApplication–60ClockHours/3SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. In this hybrid course, the online classroom will introduce the patient record. Students will learn how to modify a care plan by evaluating a patient’s respiratory status through physical assessment, visual and tactile methods, and measured vital signs. In the lab, students will apply their assessment and data logging skills via high-fidelity mannequin simulation with charting scenarios. This course will also introduce the interpretation of the recordeddatatodeterminetheprogressionofcare. RC300–RespiratoryCareFundamentalsIII–75ClockHours/4SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. The online classroom will cover patient diagnostic applications in this hybrid course, including electrocardiogram analysis, patient monitoring, and thoracic imaging. This course will explore the interpretation of laboratory values and arterial blood gas testing and its relation to ventilation, gas exchange, and acid/base balance. In the laboratory setting, students will learn to apply electrocardiogram testing, assist with patient positioning for imaging studies, and perform arterial blood gas sampling. RC320–IntroductiontoMechanicalVentilation–75ClockHours/4SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This hybrid course introduces students to mechanical ventilation theory, application, and airway management. In the classroom, students will explore respiratory failure and how it leads to the need for NIV and/or mechanical ventilation, the physiology of ventilatory support, patient-ventilator interactions, monitoring of the ventilated ICU patient, and weaning/discontinuation of ventilatory support. In the lab, students will have hands-on NIV and ventilator practice and can apply skills learned using practice lungs and high-fidelity simulation. RC330–ClinicalPracticumI–144ClockHours/3SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This clinical practicum will consist of 144 hours of supervised patient care in the hospital setting. Students will be able to perform patient assessment and low-acuity respiratory therapies. Students will be supervised by a licensed RCP preceptor employed by the hospital and have routine check-ins with a clinical instructor assigned bytheprogram. RC340–SpecializedRespiratoryCare–30ClockHours/2SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This course will explore respiratory care in specialty areas, such as e-medicine, sleep studies, skilled nursing facilities, pulmonary function testing, home care, pulmonary rehabilitation, and extracorporeal membrane oxygenation. 257

RC400–RespiratoryCareFundamentalsIV–60SemesterHours/4SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This course will explore cardiopulmonary diseases, such as pulmonary infections, chronic obstructive pulmonary disease, interstitial lung disease, pleural disease, acute respiratory distress syndrome, heart failure, lung cancer, neuromuscular disease, sleep disorders, etc. Students will examine symptoms, diagnosis, treatment, and patient management. RC420–AdvancedMechanicalVentilation–75SemesterHours/4SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This hybrid course takes an in-depth approach to managing the critically ill patient. In the classroom, students will delve deeper into the theory of mechanical ventilation and employ critical thinking skills in real-life case studies. In the lab setting, students will learn about advanced ventilator settings used in the Intensive Care Unit. RC430–ClinicalPracticumII–216SemesterHours/4.5SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This clinical practicum will consist of 216 hours of supervised patient care in the hospital setting. Students can perform patient assessment and various low-acuity respiratory therapies. Students will be supervised by a licensed RCP preceptor employed by the hospital and have routine check-ins with a clinical instructor assigned bytheprogram. RC500–NBRCReviewandTestPreparation–45SemesterHours/3SemesterCredits Prerequisite: Completion of courses in preceding modules with a “C” or better. This course will help prepare students to take the NBRC credentialing exam. Attending a provided test preparation seminar and a passing score on the practice tests will be a course requirement. RC520–NeonatalandPediatricRespiratoryCare–90SemesterHours/5SemesterCredits Prerequisite: Completion of courses in preceding modules with a “C” or better. Students will address the needs of caring for the neonatal and pediatric populations. In the classroom, students will learn maternal risk factors, the stages of fetal development, fetal circulation, transition to extrauterine life, neonatal resuscitation, how to identify and treat neonatal/pediatric respiratory disorders, and neonatal/pediatric ventilator management. In the lab, students will apply skills to set up various respiratory modalities unique to the neonatal/pediatric population and practice resuscitation using high-fidelity simulation. RC530–ClinicalPracticumIII–216SemesterHours/4.5SemesterCredits Prerequisite – Completion of courses in preceding modules with a “C” or better. This clinical practicum will consist of 216 hours of supervised patient care in the hospital setting. Students can perform patient assessment and various high-acuity respiratory therapies. Students will be supervised by a licensed RCP preceptor employed by the hospital and have routine check-ins with a clinical instructor assigned bytheprogram. Associate of Occupational Science in Radiologic Technology (A.O.S. in RT) Courses – Blended Program XRT101–PatientCareinRadiographicImaging–45ClockHours/4.0QuarterCreditHours Prerequisite: None This course introduces students to basic imaging principles and patient care. Students review medical ethics, pediatrics, and geriatrics patient care. The duties and responsibilities of working in Radiology are also presented, emphasizing communication and relationships. A review of infection control, standard precautions, andtransmission-basedprecautionscovered. The theory, basic venipuncture techniques, and the administration of diagnostic contrast agents include intravenous medications. Routine and emergency patient care procedures and the radiographer’s role in patient 258

education are reviewed. This course will include out-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. A minimum of 20 hours of outside class work will be assigned. XRT102–RadiographicProceduresI–70ClockHours/6.0QuarterCreditHours Prerequisite: Completion of XRT 101 with a “C” or better. This course introduces the medical terminology, anatomy, physiology, and common chest, thorax, and upper extremities pathologies. Routine chest, bony thorax, and upper extremity radiographic procedures are described and demonstrated. Students demonstrate competency in performing routine radiographic procedures during simulated radiographic examinations. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical assignments, and projects. A minimum of 30 hours of outside class workwillbeassigned. XRT103–RadiographicEquipmentandExposure–50ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 102 with a “C” or better. This course introduces students to concepts of radiographic image quality and the exposure factors that contribute to producing radiographic images. Students are introduced to radiographic equipment, exposure relationships, and digital factors contributing to image production. Students participate in experiments to demonstrate their knowledge, understanding, and skills by performing different techniques and exposure factors. XRT104–RadiographicProceduresII–70ClockHours/6.0QuarterCreditHours Prerequisite: Completion of XRT 103 with a “C” or better. This course introduces the medical terminology, anatomy, physiology, and common pathologies of the skeletal system, with particular emphasis on the thorax, shoulder girdle, and spine bones. Routine radiographic procedures appropriate to the thorax, shoulder girdle, and spine are described and demonstrated. Students demonstrate competency in performing torsoskeletal radiographic procedures during simulated X-ray examinations. XRT105–RadiationProtectionandPhysics–70ClockHours/7.0QuarterCreditHours Prerequisite: Completion of XRT 104 with a “C” or better. This course provides a basic overview of radiologic physics for students to understand how X-rays are produced and the various characteristics of the beam. The fundamentals of the X-ray machine components and their operation are introduced. Principles of radiation protection, responsibilities of the radiographer to patients, personnel, and the public, radiation health, and safety requirements of federal and state regulatory agencies, accreditation agencies, and medical organizations are covered. Interaction of radiation with molecules, cells, tissues, and the body as a whole,andthefactorsaffectingbiological response will be identified. XRT106–IntegrationofTheoryandPracticeFundamentals–25ClockHours/2.0QuarterCreditHours Prerequisite: Completion of XRT 105 with a “C” or better. This course focuses on activities associated with refining radiographic imaging skills and medical assistant skills application in an x-ray environment. Emphasis is placed on proper positioning. Image critique, patient care, and radiation protection are also reviewed. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical assignments, and projects. A minimum of five (5) hours of outside class work will be assigned. XRT107–ClinicalPracticeI–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 106 with a “C” or better. 259

In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT108–ClinicalPracticeII–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 107 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT109–ClinicalPracticeIII–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 108 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT110–ClinicalPracticeIV–120ClockHours/4.0QuarterCreditHours Prerequisite: Completion of XRT 109 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT201–ImagingProceduresandTechnicalFactors–30ClockHours/3.0QuarterCreditHours Prerequisite: Completion of XRT 110 with a “C” or better. This advanced imaging course enforces professionalism, ethics, legal considerations, patient care, patient safety, radiation protection and measurement, image production, radiographic imaging, and image analysis. This course will include outside-of-school preparation hours such as reading and writing assignments, practice, practical assignments, and projects. A minimum of 25 hours of outside class work will be assigned. 260

XRT202–RadiographicProceduresIII–80ClockHours/7.0QuarterCreditHours Prerequisite: Completion of XRT 201 with a “C” or better. This course provides the knowledge base to perform and apply standard radiographic procedures to special studies. Consideration is given to the production of radiographs of optimal diagnostic quality. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. XRT203–RadiographicProceduresIV–45ClockHours/4.0QuarterCreditHours Prerequisite: Completion of XRT 202 with a “C” or better. This course is designed to provide a knowledge base necessary to perform routine radiographic positions of the cranium and facial bones. Emphasis is given to special patient care considerations related to head trauma. Actual images are included for analysis. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. XRT204–RadiographicProceduresV–50ClockHours/4.5QuarterCreditHours Prerequisite: Completion of XRT 203 with a “C” or better. This course provides a knowledge base for routine radiographic positions (including chest and bony skeleton positioning, bedside and surgical examinations, and radiation protection). Actual images are included for analysis. Provide a knowledge base necessary for pediatric and geriatric radiography (including immobilization, positioning, radiation protection, and pathologic indications). This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. XRT205–DigitalImagingTechnologies–45ClockHours/4.5QuarterCreditHours Prerequisite: Completion of XRT 204 with a “C” or better. This course establishes introductory knowledge of computing and information processing. Computer applications in the radiologic sciences related to image capture, display, storage, and distribution are also presented. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. XRT206–ClinicalPracticeV–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 110 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT207–ClinicalPracticeVI–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 206 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. 261

Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT208–ClinicalPracticeVII–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 207 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT209–ClinicalPracticeVIII–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 208 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT210–ClinicalPracticeIX–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 209 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT211–ClinicalPracticeX–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 210 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. 262

XRT212–Cross-SectionalAnatomy–30ClockHours/3.0QuarterCreditHours Prerequisite: Completion of XRT 210 with a “C” or better. This course introduces the basic principles of computed tomography (CT), magnetic resonance (MR) imaging, and sectional anatomy. The history of CT/MR, current equipment and practices, radiation protection specific to CT, and the anatomic appearance of various structures in a cross-sectional reference will be discussed. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. XRT213–ClinicalPracticeXI–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 212 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT214–ClinicalPracticeXII–160ClockHours/5.0QuarterCreditHours Prerequisite: Completion of XRT 213 with a “C” or better. In this course, each content and clinical practice experience is designed for sequential development, application, critical analysis, integration, synthesis, and evaluation of concepts and theories in the performance of radiologic procedures. Through structured, sequential, competency-based assignments in a clinical setting, concepts of team practice, patient-centered clinical practice, and professional development are discussed, examined,andevaluated. Clinical practice experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Competency levels and outcomes measurement ensure the patient’s well-being preparatory to, during, and following the radiologic procedure. XRT215C–ComputedTomography–40ClockHours/4.0QuarterCreditHours Prerequisite: Completion of XRT 212 with a “C” or better. This course provides entry-level radiography students with principles related to computed tomography (CT) imaging. Special emphasis is placed on a study of the head and brain, thorax, abdomen, pelvis, shoulder, elbow, hip, and knee. Correlations between cadaver cross-sections, CTs, MRIs, and radiographs are explored. CT Basics: The Series by ASRT utilized with the course satisfies the ARRT® 16-credit structures education requirements for CT. XRT215M–Mammography–40ClockHours/4.0QuarterCreditHours Prerequisite: Completion of XRT 212 with a “C” or better. This course provides radiography students with the principles related to mammography. Topics include patient care, anatomy and physiology of the breast, positioning for routine and diagnostic exams, pathology, mammographyequipment,qualitycontrol,andqualityassurancefordigitalimagingsystems. XRT216–RadiologicTechnologySeminarI–80ClockHours/8.0QuarterCreditHours Prerequisite: Completion of XRT 214 with a “C” or better. This course teaches students the concepts and skills to prepare for the American Registry of Radiologic Technologists® (ARRT) Radiography certification examination. Topics include professional certification and licensure, patient care, radiographic procedures, radiographic protection, image production and evaluation, 263

equipmentoperation,andqualitycontrol. Emphasis is placed on digital imaging and radiographic, fluoroscopic, mobile, and tomographic equipment requirements and design, incorporating basic knowledge of quality control. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. XRT217–RadiologicTechnologySeminarII–80ClockHours/8.0QuarterCreditHours Prerequisite: Completion of XRT 216 with a “C” or better. In this course, students are taught concepts and skills to assist them in preparation for the American Registry of Radiologic Technologists® (ARRT®) Radiography certification examination. Topics include professional certification and licensure, patient care, radiographic procedures, radiographic protection, image production andevaluation, equipmentoperation,andqualitycontrol. Emphasis is placed on patient care, imaging procedures, and radiation safety and protection. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. Associate of Occupational Science in Ultrasound Technology (A.O.S. in UT) Courses – Blended Program UT200–UltrasoundPhysicsandInstrumentation–62ClockHours/6QuarterCreditHours Prerequisites: Completion of GE 112 with a “C” or better. This course teaches the fundamentals of ultrasound physics and instrumentation. The material heightens the educational experience of the future sonographer and prepares students for the SPI exam with the ARDMS. UT201–SectionalAnatomy–48ClockHours/4.5QuarterCreditHours Prerequisites: Completion of GE 021 with a “C” or better. This course introduces cross-sectional human anatomy as seen in sonograms and other imaging modalities. Cross-sectional anatomy emphasizes the physical relationship of structures, which is the basis of understanding sonographic images. Cross-sectional anatomy is the first building block to understanding what is required when performing ultrasound images. Students will learn to recognize different organs, muscles, vessels, and other bodypartsintheirrelationship. An interactive computer program will be used as a teaching tool. UT301–PatientCareforUltrasoundProfessional–12ClockHours/1QuarterCreditHours Prerequisites: Completion of courses in preceding modules with a “C” or better. Thecoursegivesstudentsanoverviewofthesonographyprofessionandbasicpatientcare.Thiscourseteaches theessential role sonography and the sonographer play in medicine. The ARDMS “Sonography Principles and Instrumentation” exam consists of 10% patient care, which this course will thoroughly prepare the student to pass. UT302–AbdominalSonography1–84ClockHours/8QuarterCreditHours Prerequisites: Completion of Module I and II courses with a “C” or better and concurrent enrollment with all ModuleIIIUTdidacticorlaboratorycourses. This course introduces the anatomy and basic protocols that pertain to ultrasound examinations of the abdominalorgans.Thiscourseestablishesfoundationsforscanningtechniques,protocols,andpatientbody habitus variations. Students learn the sonographer’s role in diagnosing diseases of the abdominal organs by understandingthecriteria for “normal.” UT302L–LaboratoryAbdominalSonography1–84ClockHours/4QuarterCreditHours Prerequisites: Completion of Module I and II courses with a “C” or better and concurrent enrollment with all ModuleIIIUTdidacticorlaboratorycourses. 264

This course is concurrent with the lecture portion of Abdominal Sonography 1. Students will practice the protocols and scanning techniques within the lab. This course will set the foundation of protocols to build on themwithadvancedtechniquestaughtinothercourses. UT303–SmallPartsSonography1–28ClockHours/2.5QuarterCreditHours Prerequisites: Completion of Module I and II courses with a “C” or better and concurrent enrollment with all ModuleIIIUTdidacticorlaboratorycourses. Small Parts Sonography 1 course covers complete breast sonography and the basics of thyroid, parathyroid, neckglands,scrotum,andprostatesonography.Studentswilllearnthebasicnormalanatomy,scanning techniques, and expectations of a sonographer when performing these exams. UT303L–LaboratorySmallPartsSonography1–28ClockHours/1QuarterCreditHour Prerequisites: Completion of Module I and II courses with a “C” or better and concurrent enrollment with all ModuleIIIUTdidacticorlaboratorycourses. This course covers the basics of thyroid, parathyroid, neck glands, and scrotum sonography. Students will also learn proper annotation regarding all organs and the breast. Students will learn the basic normal anatomy, scanning techniques, and expectations of a sonographer when performing these exams. Patient care skills will betaught.Thereisascrotalphantominthelabthatstudentscanusetoscan.Thiswillenablethemtopractice scanning techniques and recognize pathology (scrotal phantom). UT304–SmallPartsSonography2–12ClockHours/1QuarterCreditHour Prerequisites: Completion of Module I and II courses with a “C” or better. This course focuses on the common diseases that affect the thyroid, scrotum, and prostate. Students will learn to correlate lab tests and other modalities to assist physicians with correct diagnosis and ultrasound imaging. Students will learn to present normal vs. abnormal and what is required when writing a report. Interventional proceduressuchasbiopsiesandbrachytherapywillbecoveredasultrasound’srolewitheachexam.Patient care techniques will be addressed with each type of exam. UT304L–LaboratorySmallPartsSonography2–12ClockHours/0.5QuarterCreditHours Prerequisites: Completion of Module I and II courses with a “C” or better and concurrent enrollment with all ModuleIIIUTdidacticorlaboratorycourses. This course focuses on advanced scanning techniques of the thyroid and the scrotum using a phantom. The Dopplerevaluationanditsuseindiagnosingmultiplediseaseprocesseswillbecovered.SIMTICSisrequiredin thelabtopracticeprotocolsandrecognizepathology.Breastpathologywillbereviewedinclass. UT402–AbdominalSonography2–68ClockHours/6.5QuarterCreditHours Prerequisites: Completion of Module I, II, and III courses with a “C” or better and concurrent enrollment with all ModuleIVUTdidacticorlaboratorycourses. Abdominal Sonography 2 is a progression of UT 302-Abdominal Sonography 1. This course builds on the foundations set in the instruction process of protocols and scanning techniques. The students will learn additional anatomy pertinent to sonographic imaging along with skills in the diagnostic process. The common disease processes of each organ will be covered with instructions on identifying and presenting suspected diseases and disease processes using other diagnostic tools such as patient history, lab results, and correlation with other imaging modalities. Doppler of the abdominal vessels will be taught as a tool to discover and prove disease processes of organs. UT402L–LaboratoryAbdominalSonography2–68ClockHours/3QuarterCreditHours Prerequisites: Completion of Module I, II, and III courses with a “C” or better and concurrent enrollment with all ModuleIVUTdidacticorlaboratorycourses. This course builds on the foundations of protocols and scanning techniques in instruction. The students will learn additional anatomy pertinent to sonographic imaging and skills in the diagnostic process. The common 265

disease processes of each organ will be covered with the instruction on identifying and presenting suspected diseases using other diagnostic tools such as patient history, lab results, and correlation with other modalities. Doppleroftheabdominalvesselswillbetaughtasatooltodiscoverandprovethediseaseprocessesofcertain organs. Mid-moduleassessmentswillbeconductedinthiscourse.Mid-moduleassessmentsaredonetoverify if the student is at the scanning level expected at this stage of the course. Different groups have different levels of expectations depending on start dates. Mid-module assessments are not part of the grade. However, if the student fails, they will be put on academic probation in addition to documentation stating that the scanning level is below expectation. UT405–NeonatalSonography–32ClockHours/3QuarterCreditHours Prerequisites: Completion of Module I, II, and III courses with a “C” or better and concurrent enrollment with all ModuleIVUTdidacticorlaboratorycourses. This course covers the exams required of sonographers of neonatal patients. The main focus will be neonatal brain sonography, lumbar spine sonography, and infant hip joint sonography. Students will learn the normal and abnormalfindingsandpatientcareoftheprematurepatient. UT406–PediatricSonography–28ClockHours/2.5QuarterCreditHours Prerequisites: Completion of Module I, II, and III courses with a “C” or better and concurrent enrollment with all ModuleIVUTdidacticorlaboratorycourses. This course covers the disease processes specific to the pediatric abdominal patient. Students will already know thebasicanatomyandphysiologyoftheabdomenandrecognizeandpresentabnormalities.Patientcare techniques with the pediatric patient will be covered along with protocols and scanning techniques. UT410–IntegrationofTheoryandPracticeLab1–16ClockHours/0.5QuarterCreditHours Prerequisites: Completion of Module I, II, and III courses with a “C” or better and concurrent enrollment with UT 405. This course is designed to allow the students to continue scanning during the concurrent didactic portion of their education. The Integration of Theory and Practice Lab courses are designed to allow students to continue building on their scanning skills during didactic courses that do not allow scanning, i.e., OB, neonate, and pediatrics. Students will continue practicing the protocols and scanning techniques of the prior lab courses (abdomen,vascular,gynecology,and/orsmallparts). This class allows the students to work on their scanning speed and advanced techniques, such as intercostal scanning. Newstudentswill be introduced to the protocols and begin building on their scanning skills. Also, critical thinking scenarios will be applied to the lessons in the lab to ensure students understand normal anatomyvs.pathology. UT504A–VascularSonography1–28ClockHours/2.5QuarterCreditHours Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. Students learn vascular terminology and advanced vascular physical principles. Anatomy and hemodynamic characteristics of the arteries and veins of the lower extremities will be the main focus of this course. Scanning techniques and protocols will be taught and challenged in the clinical setting. UT504AL–LaboratoryVascularSonography1–28ClockHours/1QuarterCreditHour Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. This course will review Doppler sonography within the lab setting. Students will learn techniques and skills for theoptimization of the vascular examination. Laboratory Vascular 1 focuses on the lower extremity venous systemprotocols. This will introduce and prepare students for studies for deep vein thrombosis disease. 266

UT504B–VascularSonography2–28ClockHours/2.5QuarterCreditHours Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. Students will learn vascular terminology and advanced vascular physical principles. Anatomy and hemodynamic characteristics of the lower extremity arterial system will be the main focus of this course. Scanning techniques andprotocolswill be taught as challenges in the clinical setting. UT504BL–LaboratoryVascularSonography2–28ClockHours/1QuarterCreditHour Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. This course will review Doppler sonography within the lab setting. Students will learn techniques and skills for theoptimization of the vascular examination. The focus is on the lower extremity arterial system protocol. Indirect assessment of the arteries will also be introduced and taught with the lab’s ABI machine. This will introduce and prepare students for studies on peripheral vascular disease. UT504C–VascularSonography3–28ClockHours/2.5QuarterCreditHours Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. This course covers extracranial sonography and the protocols and scanning techniques required for diagnostic exams. UT504CL–LaboratoryVascularSonography3–28ClockHours/1QuarterCreditHour Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. This course will focus on the Extracranial and Intracranial Doppler, primarily carotid artery and TCD ultrasound exams.StudentswilllearntouseDopplervelocitiesandcreateratiosthatdeterminenormalvs.abnormalflow. Students will learn carotid and TCD protocols and scanning techniques to perform the complete exams in 45 minutes. UT504D–VascularSonography4–24ClockHours/2QuarterCreditHours Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. This course focuses on upper extremity venous vascular protocols. Vascular hemodynamics and physical principles are reviewed and practiced. Scanning skills and techniques are taught to recognize the normal and abnormalanatomyanddisease(anddiseaseprocesses)oftheupperextremities. UT504DL–LaboratoryVascularSonography4–24ClockHours/1QuarterCreditHour Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. This course will review Doppler sonography within the lab setting. Students will learn techniques and skills for optimizing the upper arterial vascular examination. Students will be taught upper arterial extremity protocols. Indirect assessment of the arteries will also be introduced and taught with the lab’s ABI machine. This will introduce and prepare students for peripheral vascular disease. UT505–MSK–20ClockHours/2QuarterCreditHours Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. This course is a basic introduction to the anatomy and physiology of the shoulder, knee, and Achilles tendon.ScanningtechniquesandspecificsofMSKscanninginsonographywillbecovered.Basic sonographyknowledgeandskillswillbepresented. UT505L–LaboratoryMSK–20ClockHours/1QuarterCreditHour 267

Prerequisites: Completion of Module I, II, III, and IV courses with a “C” or better and concurrent enrollment with all Module V UT didactic and laboratory courses. Students will scan normal MSK anatomy and acquire the skills and techniques to present normal structures with ultrasound. Basic sonography knowledge and skills will be presented at two levels, “Introduction” and “Review.” This will enrich the students’ scanning skills in preparing for the externship. UT607A–Gynecology1–24ClockHours/2QuarterCreditHours Prerequisites: Completion of Module I, II, III, IV, and V courses with a “C” or better and concurrent enrollment with all Module VI UT didactic and laboratory courses. This moduleintroducesgynecologysonography.Studentswilllearntheanatomyandphysiologyofthefemale pelvis and embryology and congenital anomalies. UT607B–Gynecology2–28ClockHours/2.5QuarterCreditHours Prerequisites: Completion of Module I, II, III, IV, and V courses with a “C” or better and concurrent enrollment with all Module VI UT didactic and laboratory courses. This course will cover the pathology found during gynecologic ultrasound examinations. Students will learn sonographic features of malignant and benign disease processes, including required correlation with clinical, laboratory, and pathologic findings. UT607L–LaboratoryGynecologySonography–52ClockHours/2.5QuarterCreditHours Prerequisites: Completion of Module I, II, III, IV, and V courses with a “C” or better and concurrent enrollment with all Module VI UT didactic and laboratory courses. This module covers protocols for sonography of the female pelvis. Students will learn the basic protocol and the Doppler portions included in most facility protocols. Students will understand why images are needed and learn patient care components such as communication skills, endovaginal sonography techniques, and disinfection requirements. UT609A–ObstetricSonography1–32ClockHours/3QuarterCreditHours Prerequisites: Completion of modules I, II, and V is required with a “C” or better and concurrent enrollment with all Module VI UT didactic and laboratory courses. This course covers the first and second trimesters of pregnancy. Students will learn the indications for an OB first trimester sonogram and the normal vs. abnormal sonographic findings. Students will learn about the developmentoftheplacentaandtheumbilicalcordandtheirrolesinpregnancy.Studentswilllearntouse second-trimester biometric parameters and determine fetal dating. Students will be introduced to biophysical profiles and recognition of intrauterine growth retardation. UT609B–ObstetricSonography2–62ClockHours/6QuarterCreditHours Prerequisites: Completion of modules I, II, and V with a “C” or better and concurrent enrollment with all Module VI UT didactic and laboratory courses. This course covers pregnancy’s second and third trimesters and the fetal anatomical and physiological systems, including normal and abnormal findings. Students will continue learning the correct protocols for each trimester, including biometric measurements, required organs, amniotic fluid volume, placenta grade, position, numberofpregnancies,andlungmaturity.Variousanomalieswillbecovered,andprotocolswillbefollowedif abnormalities are detected. Students will be introduced to prenatal testing. Multiple gestations and risk factors for multiple gestations will also be covered. UT610–IntegrationofTheoryandPracticeLab2–88ClockHours/4QuarterCreditHours Prerequisites: Completion of modules I, II, and V with a “C” or better and concurrent enrollment with all Module VI UT didactic and laboratory courses. This course is designed to allow the students to continue scanning during the concurrent didactic portion of their education. The Integration of Theory and Practice Lab courses are designed to allow students to continue 268

building on their scanning skills during didactic courses that do not allow scanning, i.e., OB, neonate, and pediatrics. Students will continue practicing the protocols and scanning techniques of the prior lab courses (abdomen, vascular, gynecology, and/or small parts). This class allows the students to work on their scanning speed and advancedtechniques,suchasintercostalscanning.Newstudentswillbeintroducedtotheprotocolsandbegin building on their scanning skills. Also, critical thinking scenarios will be applied to the lessons in the lab to ensurestudentsunderstandnormalanatomyvs.pathology. UT620A–MasterScanningLabExtracranialVascularDuplexExam–8ClockHours/0.5QuarterCreditHours Prerequisites: Completion of courses in preceding modules with a “C” or better. MasterScanningLabs(MSL)areadvancedvascularclassestaughtbyexpertsinvascularsonography.Students havelearnedbasicvascularskills during Vascular Sonography courses 1-4 and Vascular Sonography Lab courses 1-4. MSL classes will build and enrich knowledge and skills to be successful in vascular sonography. Master Scan Labcoursesareofferedonceamonthforsevenconsecutivemonths.Pleasecheckwithinstructorsfordates. This course provides the learner with an overview of duplex imaging of the extracranial cerebrovascular system, including Vertebral and Subclavian arteries, to evaluate Cerebrovascular Disease. Course study includes normal andabnormalcross-sectionanatomy,hemodynamics,spectralanalysis,clinicalsignsandsymptoms,indications for exams, definitions of terms, scanning protocol, instrumentation, sonographic techniques (grayscale conventional, color Doppler, color with spectral Doppler, and power Doppler) and examples of common carotid, vertebral and Subclavian artery pathology. Clinical hands-on training integrated with didactic instruction is the primaryfocusofthisprogram.Rubricsevaluationdemonstratingdiagnosticcompetencyisrequired. UT701–Clinical3–288ClockHours/9.5QuarterCreditHours Prerequisites: Completion of Modules I, II, III, IV, V, and VI and Clinical 1 and 2 with a “C” or better. This course comprises twelve weeks of Level 3 externship integrated within UT Module courses. Externship expectations will vary as to the externship site assignment for each student. This allows the student to relate theory to practice in a supervised situation. Thestudent’sability to perform correct protocols and acquire effective patient diagnostic information is evidencedbymeetingspecificobjectivesandcompetenciesineachclinicalspecialtyarea.Level1competency evaluation will be signed off by clinical instructors on Trajecsys and reviewed by the clinical coordinator. AClinical Instructor (CI) Preceptor Handbook is provided for each site supervisor. The handbook guides the CI anddepartmentstaffregardingtheexpectationsoftheultrasoundextern.UT-701alsoconsistsofassignments onMoodleforARDMSpreparation.TheemphasiswillbeontheSPIpreparationtoencouragestudentstotake theARDMSSPIexambeforegraduation.ARDMSpreparationinAbdomenandOB/GYNisalsoprovided. Therearevirtual labs on Moodle to be used if clinical site assignment is unavailable for reasons determined by theclinical site and the school. The clinical coordinator may give virtual lab assignments for extra learning opportunities or make-up assignments. UT720B–MasterScanningLabLowerExtremityVenousExam–8ClockHours/0.5QuarterCreditHours Prerequisites: Completion of courses in preceding modules with a “C” or better. MasterScanningLabs(MSL)areadvancedvascularclassestaughtbyexpertsinvascularsonography.Students havelearnedbasicvascularskills during Vascular Sonography courses 1-4 and Vascular Sonography Lab courses 1-4. MSL classes will build and enrich knowledge and skills to be successful in vascular sonography. Master Scan Labcoursesareofferedonceamonthforsevenconsecutivemonths.Pleasecheckwithinstructorsfordates. This course provides the learner with an overview of duplex imaging of the venous system in the lower extremity, including all the deep veins in the calf, for evaluating Deep and Superficial Venous Thrombosis (DVT). 269

Areascoveredincludenormalandabnormalcross-sectionanatomy,etiologyof(venousthrombosis),risk factors, classification of venous thrombosis, clinical signs and symptoms, indications, limitations, pitfalls, the definition of terms, scanning protocol, instrumentation, and sonographic technique (grayscale conventional, color Doppler, color with spectral Doppler, and power Doppler). Clinical hands-on training integrated with didactic instruction is the primary focus of this program. Rubrics evaluation demonstrating diagnostic competency is required. UT720C–MasterScanningLabLowerExtremityArterialExam–8ClockHours/0.5QuarterCreditHours Prerequisites: Completion of courses in preceding modules with a “C” or better. MasterScanningLabs(MSL)areadvancedvascularclassestaughtbyexpertsinvascularsonography.Students havelearnedbasicvascularskills during Vascular Sonography courses 1-4 and Vascular Sonography Lab courses 1-4. MSL classes will build and enrich the knowledge and skills of students in vascular sonography. Master Scan Labcoursesareofferedonceamonthforsevenconsecutivemonths.Pleasecheckwithinstructorsfordates. This course gives the learner an overview of duplex imaging of the lower extremity arterial system (native and graft) for evaluating peripheral vascular disease (PAD). Areas covered include an overview of (PAD), risk factors, acute and chronic obstruction, normal and abnormal cross-section anatomy, hemodynamics, spectral analysis, clinical signs and symptoms, indications, the definition of terms, scanning protocol, instrumentation, and sonographic technique (grayscale conventional, color Doppler, color with Spectral Doppler, and power Doppler). Normalandabnormalcriteriawillbereviewedtoclassifytheseverityoftheperipheralarterialdisease.Types of bypass grafts and evaluation protocols will be discussed and reviewed. Examples of common lower extremity arterial disease will be shown to familiarize the learner with common pathologies seen when performing duplex mappingoflowerextremityarteries.Ancillaryfindings such as Pseudoaneurysm, AV-Fistula, and Aortic Aneurysmswillbereviewed.ABIandTBIevaluationcriteriawillbereviewed. Clinical hands-on training integrated with didactic instruction is the primary focus of this program. Rubrics evaluation demonstrating diagnostic competency is required. UT720D–MasterScanningLabUpperExtremityVenousExam–8ClockHours/0.5QuarterCreditHours Prerequisites: Completion of courses in preceding modules with a “C” or better. MasterScanningLabs(MSL)areadvancedvascularclassestaughtbyexpertsinvascularsonography.Students havelearnedbasicvascularskills during Vascular Sonography courses 1-4 and Vascular Sonography Lab courses 1-4. MSL classes will build and enrich knowledge and skills to be successful in vascular sonography. Master Scan Labcoursesareofferedonceamonthforseven(7)consecutivemonths.Pleasecheckwithinstructorsfordates. This course provides the learner with an overview of duplex imaging of the venous system in the upper extremity to evaluate Deep and Superficial Venous Thrombosis (DVT). Areas covered include normal and abnormalcross-section anatomy, etiology of (venous thrombosis), risk factors, classification of venous thrombosis, hemodynamics,spectralanalysis, clinical signs and symptoms, indications, predisposing factors, PICClines, pacemaker leads, stents, ancillary findings, pitfalls, limitations, scanning protocol, patient position, instrumentation, and sonographic technique (grayscale conventional, color Doppler, color with spectral Doppler, andpowerDoppler).Clinicalhands-ontrainingintegratedwithdidacticinstruction is the primary focus of this program.Rubricsevaluationdemonstratingdiagnosticcompetencyisrequired. UT801–Clinical4–288ClockHours/9.5QuarterCreditHours Prerequisites: Completion of Modules I, II, III, IV, V, VI, and VII and Clinical 1, 2, and 3 with a “C” or better. This course comprises twelve weeks of Level 4 externship integrated within AOSUT Module courses. Externship expectations will vary as to the externship site assignment for each student. This allows the student to relate theory to practice in a supervised situation. 270

Thestudent’sability to perform correct protocols and acquire effective patient diagnostic information is evidencedbymeetingspecificobjectivesandcompetenciesineachclinicalspecialtyarea.Level4competency evaluation will be signed off by clinical instructors on Trajecsys and reviewed by the clinical coordinator. AClinical Instructor (CI) Preceptor Handbook is provided for each site supervisor. The handbook guides the CI anddepartmentstaffregardingtheexpectationsoftheultrasoundintern.UT-801alsoconsistsofassignments onMoodleforARDMSpreparation.TheemphasiswillbeontheSPIpreparationtoencouragestudentsin UT-801totaketheARDMSSPIexambeforegraduation.ARDMSpreparationinAbdomenandOB/GYNisalso provided. Therearevirtual labs on Moodle to be used if clinical site assignment is unavailable for reasons determined by theclinical site and the school. The clinical coordinator may give virtual lab assignments for extra learning opportunities or make-up assignments. UT820E–MasterScanningLabDuplexEvaluationofthePortalVenousSystemforPortalHypertension–8 Clock Hours/0.5 Quarter Credit Hours Prerequisites: Completion of courses in preceding modules with a “C” or better. This course provides the learner with an overview of duplex imaging of the portal, splenic, hepatic, and mesentericvessels in the abdomen to evaluate Portal Hypertension, Portal Vein Thrombosis, Budd Chiari Syndrome,andTransjugularPortosystemicShuntmalfunction. Areascoveredincludenormalandabnormalsonographicanatomyofthehepatoportalsystem,causesand levels of obstruction relating to hepatoportal obstruction, hemodynamics, spectral analysis, clinical signs and symptoms,indications, definition of terms, scanning protocol, instrumentation, and sonographic technique (grayscale conventional, color Doppler, color with spectral Doppler, and power Doppler). Clinical hands-on training integrated with didactic instruction is the primary focus of this program. UT820F–MasterScanningLabLowerExtremityVenousValveInsufficiencyDuplexExam–8ClockHours/0.5 QuarterCreditHours Prerequisites: Completion of courses in preceding modules with a “C” or better. MasterScanningLabs(MSL)areadvancedvascularclassestaughtbyexpertsinvascularsonography.Students havelearnedbasicvascularskills during Vascular Sonography courses 1-4 and Vascular Sonography Lab courses 1-4. MSL classes will build and enrich knowledge and skills to be successful in vascular sonography. Master Scan Labcoursesareofferedonceamonthforseven(7)consecutivemonths.Pleasecheckwithinstructorsfordates. Theone-daybasicultrasoundcourseprovidesthestudentwithanoverviewofanatomy,pathology,andduplex imagingofthevenoussystemofthelowerextremityfortheevaluationofdeep,superficial,andperforator incompetencyinpatientswithChronicVenousInsufficiency(CVI).Areascoveredincludenormalandabnormal cross-section anatomy, hemodynamics, spectral analysis, clinical signs and symptoms, indication, the definition of terms, scanning protocol, instrumentation, and sonographic technique (black and white conventional and color Doppler). Clinical hands-on training integrated with didactic instruction is the primary focus of this program. UT820G–MasterScanningLabUpperExtremityMappingforDialysisAccess–8ClockHours/0.5Quarter Credit Hours Prerequisites: Completion of courses in preceding modules with a “C” or better. This course teaches the fundamentals of upper extremity mapping for dialysis access. The material is presented to heighten the future sonographer’s educational experience and prepare the student for the dialysis patient. UTX01–Clinical1–192ClockHours/6QuarterCreditHours Prerequisites: Completion of Modules I, II, III, and IV courses, concurrent enrollment in Module V or completion of ModulesI, II, V, and VI courses, and concurrent enrollment in Module III, with a “C” or better. 271

This course comprises twelve weeks of Level 1 externship integrated within AOSUT Module courses. Externship expectations will vary as to the externship site assignment for each student. This allows the student to relate theory to practice in a supervised situation. Thestudent’sability to perform correct protocols and acquire effective patient diagnostic information is evidencedbymeetingspecificobjectivesandcompetenciesineachclinicalspecialtyarea.Level1competency evaluation will be signed off by clinical instructors on the Trajecsys Report system and reviewed by the clinical coordinator. AClinical Instructor (CI) Preceptor Handbook is provided for each site supervisor. The handbook guides the CI anddepartmentstaffregardingtheexpectationsoftheultrasoundextern.Thiscoursealsoconsistsof assignmentsonMoodleforARDMSpreparation.EmphasisisontheSPIpreparationtoencouragestudentsto take the ARDMSSPIexambeforegraduation. Therearevirtual labs on Moodle to be used if clinical site assignment is unavailable for reasons determined by theclinical site and the school. The clinical coordinator may give virtual lab assignments for extra learning opportunities or make-up assignments. UTX02–Clinical2–192ClockHours/6QuarterCreditHours Prerequisite: Completion of Modules I, II, III, IV, and V or completion of Modules I, II, III, V, and VI with a “C” or better. UT X02 is twelve weeks of externship integrated with UT Module IV or VI. This course comprises twelve weeks of Level 1 externship integrated within AOSUT Module courses. Externship expectations will vary as to the clinical site assignment for each student. This allows the student to relate theory to practice in a supervised situation. Thestudent’sability to perform correct protocols and acquire effective patient diagnostic information is evidencedbymeetingspecificobjectivesandcompetenciesineachclinicalspecialtyarea.Level1competency evaluation will be signed off by clinical instructors on the Trajecsys Report System and reviewed by the clinical coordinator. AClinical Instructor (CI) Preceptor Handbook is provided for each site supervisor. The handbook guides the CI anddepartmentstaffregardingtheexpectationsoftheultrasoundintern.Thiscoursealsoconsistsof assignmentsonMoodleforARDMSpreparation.TheemphasiswillbeontheSPIpreparationtoencourage students to take the ARDMS SPI exam before graduation. Therearevirtual labs on Moodle to be used if clinical site assignment is unavailable for reasons determined by theclinical site and the school. The clinical coordinator may give virtual lab assignments for extra learning opportunities or make-up assignments. Associate of Occupational Science in Vascular Ultrasound Technology (A.O.S. in VUT) Courses – Blended Program VU300–CerebrovascularSonography–60ClockHours/6QuarterCreditHours Completion of ModuleIandIIcourseswitha“C”orbetterisrequired.Concurrentenrollmentisrequiredwithall ModuleIIIVUcourses. This course covers extracranial and intracranial sonography. The anatomy of the extracranial and intracranial systems, and normal and abnormal findings will be covered. Protocols and scanning techniques required for diagnostic exams will be taught. VU300L–CerebrovascularSonographyLab—60ClockHours/3QuarterCreditHours Completion of ModuleIandIIcourseswitha“C”orbetterisrequired.Concurrentenrollmentisrequiredwithall ModuleIIIVUcourses. 272

Extracranial and intracranial Doppler will be the focus of this course, primarily carotid artery ultrasound and TCD exams. Students will learn to use Doppler velocities and create ratios that determine normal vs. abnormal flow. Students will learn carotid and TCD protocols and hands-on scanning techniques to perform the exam in 45minutes. VU301–AbdominalVascularSonography–84ClockHours/8QuarterCreditHours Completion of ModuleIandIIcourseswitha“C”orbetterisrequired.Concurrentenrollmentisrequiredwithall ModuleIIIVUcourses. Abdominal Vascular Sonography teaches abdominal vascular vessels and basic protocols that pertain to ultrasound examinations of the abdominal vascular system. This course establishes foundations for scanning techniques, protocols, and patient body habitus variations. Students will gain an understanding of the role a sonographer plays in the diagnosis of diseases of the abdominal vascular system by understanding what the criteria for “normal is.” Students will also understand howto identify pathology in the abdominal vascular system. They will recognize spectral Doppler and color on normalanddiseasedwaveformsoftheabdominalvascularsystem. VU301L–AbdominalVascularSonographyLab–84ClockHours/4QuarterCreditHours Prerequisite: Completion of Module I and II courses with a “C” or better is required. Concurrent enrollment is required with all Module III VU courses. Abdominal Vascular Sonography Lab is concurrent with Abdominal Vascular Sonography, VU 301. Students will practice the protocols and scanning techniques of the abdominal vascular system within the lab. VU400–LowerExtremityVenousSystem–36ClockHours/3.5QuarterCreditHours Prerequisite: Completion of Module I, II, and III courses with a “C” or better is required. Concurrent enrollment is required with all Module IV VU courses. Students will learn vascular terminology and advanced vascular physical principles. This course’s main focus will be the anatomy and hemodynamic characteristics of the lower extremities veins. Scanning techniques and protocols will be taught and challenged in the clinical setting. VU400L–LowerExtremityVenousSystemLab–36ClockHours/1.5QuarterCreditHours Prerequisite: Completion of Module I, II, and III courses with a “C” or better is required. Concurrent enrollment is required with all Module IV VU courses. This course will review Doppler sonography within the lab setting. Students will learn techniques and skills for optimizing the lower extremity venous examination. The focus of this course is the lower extremity venous system protocol. Superficial venous vein mapping will also be included in this course. This will introduce and preparestudentsforstudiesfordeepveinthrombosis,venousdisease,andsuperficialvenousdisease. VU401–LowerExtremityArterialSystem–36ClockHours/3.5QuarterCreditHours Prerequisite: Completion of Module I, II, and III courses with a “C” or better is required. Concurrent enrollment is required with all Module IV VU courses. Students will learn vascular terminology and advanced vascular physical principles. Anatomy and hemodynamic characteristics of the lower extremity arterial system will be the main focus of this course. Scanning techniques andprotocolswill be taught and challenged in the clinical setting. VU401L–LowerExtremityArterialSystemLab–36ClockHours/1.5QuarterCreditHours Prerequisite: Completion of Module I, II, and III courses with a “C” or better is required. Concurrent enrollment is required with all Module IV VU courses. This course will review Doppler sonography within the lab setting. Students will learn techniques and skills for the optimization of the vascular examination. The focus is on the lower extremity arterial system protocol. Indirect assessment of the arteries will also be introduced and taught with the lab’s ABI machine. This will introduce and prepare students for studies on peripheral vascular disease. 273

VU402–UpperExtremityVenousSystem–36ClockHours/3.5QuarterCreditHours Prerequisite: Completion of Module I, II, and III courses with a “C” or better is required. Concurrent enrollment is required with all Module IV VU courses. Upper extremity venous vascular protocols are the main focus of this course. Vascular hemodynamics and physical principles are reviewed and practiced. Scanning skills and techniques are taught to recognize the normalandabnormalanatomyanddisease(anddiseaseprocesses)oftheupperextremities. VU402L–UpperExtremityVenousSystemLab–36ClockHours/1.5QuarterCreditHours Prerequisite: Completion of Module I, II, and III courses with a “C” or better is required. Concurrent enrollment is required with all Module IV VU courses. Upper extremity venous protocols will be demonstrated, practiced, and evaluated. Students will learn scanning techniques of required anatomy and what is required to prove normal vs. abnormal. VU403–UpperExtremityArterialSystem–28ClockHours/2.5QuarterCreditHours Prerequisite: Completion of Module I, II, and III courses with a “C” or better is required. Concurrent enrollment is required with all Module IV VU courses. Upper extremity arterial vascular protocols are the main focus of this course. Vascular hemodynamics and physical principles are reviewed and practiced. Scanning skills and techniques are taught to recognize the normalandabnormalanatomyanddisease(anddiseaseprocesses)oftheupperextremities. VU403L–UpperExtremityArterialSystemLab–28ClockHours/1QuarterCreditHour Prerequisite: Completion of Module I, II, and III courses with a “C” or better is required. Concurrent enrollment is required with all Module IV VU courses. This course will review Doppler sonography within the lab setting. Students will learn techniques and skills for optimizing the upper arterial vascular examination. Students will be taught upper arterial extremity protocols. Indirect assessment of the arteries will also be introduced and taught with the lab’s ABI machine. This will introduce and prepare students for peripheral vascular disease. VUX01–Clinical1–400ClockHours/13QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. VU X01 is twelve weeks of Level 1 externship, integrated within VU Module courses. Externship expectations will vary as to the externship site assignment for each student. This allows the student to relate theory to practice in a supervised situation. The student’s ability to perform correct protocols and acquire effective patient diagnostic information is evidenced by meeting specific objectives and competencies in each clinical specialty area. Level 1 competency evaluation will be signed off by clinical instructors on Trajecsys and reviewed by the clinical coordinator. A Clinical Instructor (CI) Preceptor Handbook is provided for each site supervisor. The handbook guides the CI and department staff regarding the expectations of the ultrasound extern. VU X01 also consists of assignmentsonMoodleforARDMSpreparation. The emphasis will be on the SPI preparation to encourage students in VU X01 to take the ARDMS SPI exam before graduation. There are virtual labs on Moodle to be used if clinical site assignment is unavailable for reasons determined by the clinical site and the school. The clinical coordinator may give virtual lab assignmentsforextralearningopportunities or make-up assignments. VUX02–Clinical2–400ClockHours/13QuarterCreditHours Prerequisite: Completion of courses in preceding modules with a “C” or better. VUX02istwelveweeksofLevel2externship,integratedwithinVUModulecourses.Externshipexpectations 274

will vary as to the externship site assignment for each student. This allows the student to relate theory to practice in a supervised situation. The student’s ability to perform correct protocols and acquire effective patient diagnostic information is evidenced by meeting specific objectives and competencies in each clinical specialty area. Level 2 competency evaluation will be signed off by clinical instructors on Trajecsys and reviewed by the clinical coordinator. A Clinical Instructor (CI) Preceptor Handbook is provided for each site supervisor. The handbook guides the CI and department staff regarding the expectations of the ultrasound extern. VU X02 also consists of assignmentsonMoodleforARDMSpreparation. The emphasis will be on the SPI preparation to encourage students in VU X02 to take the ARDMS SPI exam before graduation. There are virtual labs on Moodle to be used if clinical site assignment is unavailable for reasons determined by the clinical site and the school. The clinical coordinator may give virtual lab assignmentsforextralearningopportunities or make-up assignments. Associate of Science in Magnetic Resonance Imaging (A.S. in MRI) Courses – Blended Program MR001–IntroductiontoMRI–120ClockHours/12QuarterCreditHours Prerequisite: None This course introduces the MRI training program. The one hundred and twenty (120) hours of didactic instruction will prepare students for clinical, which begins in the fourth week, ensuring safety in MRI technology. This course will give the student an overview of Magnetic Resonance Imaging and Safety. Program policies and student responsibilities will be outlined. ThefundamentalprinciplesofMRI,equipment,andterminologywillbeintroduced.Theroleofthe technologist in maintaining patient safety and comfort and coworkers’ safety is discussed. A brief introduction to imaging parameters and the clinical application of MRI is included. The student will be introduced to the basic setup for most routine MRI procedures. MR101–SectionalAnatomyI–24ClockHours/2QuarterCreditHours Prerequisite: None This course studies human anatomy in axial, sagittal, and coronal planes. Other imaging planes are studied whenrelevantfordemonstratinganatomyinspecificregions.CorrelationtoMRIispracticedinthiscourse. Bony, muscular, vascular, organs, and soft tissues of the following anatomical regions are studied: the central nervoussystem(brainandspine),otherstructuresinthehead,softtissueneck,musculoskeletal, cardiovascular, thorax, abdomen, and pelvis. MR102–MedicalTerminologyI–18ClockHours/1.5QuarterCreditHours Prerequisite: None This course introduces the student to medical and pathological terms related to specific body systems. Through lectures, discussions, demonstrations, visual aids, and self-study, the student will develop knowledge and understandingoftheprofessionallanguagetofunctionandcommunicateeffectivelywithothermedicalteam members. MR103–PhysicalPrinciplesofMRI–54ClockHours/5QuarterCreditHours Prerequisite: None This unit provides the student with a comprehensive overview of MR imaging principles. The subjects are formattedinindividual outlines and sequenced according to the level of knowledge desired. Topics include the history of MR, nuclear MR signal production, tissue characteristics, pulse sequencing, imaging parameters/options, and image formation. 275

MR104–PatientCare–36ClockHours/3.5QuarterCreditHours Prerequisite: None This course is designed to provide the basic concepts of patient care, including consideration for the patients’ andfamilies’ physical and psychological needs. Routine and emergency patient care and infection control proceduresutilizing standard precautions will be described. The role of the MRI technologist in patient education will be identified, including ethics, communication, and age-appropriate care. MR111–MRIClinicalI–264ClockHours/8.5QuarterCreditHours Prerequisite: None This course allows students to practice the skills necessary to obtain high-quality MR images, objectively alter protocols based on patient pathology or physical condition, identify image quality problems, and make appropriate corrections. The clinical is conducted at a clinical facility after or with didactic instruction. Activities include demonstration and observation, after which the student assists in performing the activity. Thestudentcanperformtheactivityunderdirectsupervisionwhensatisfactoryproficiencyisapparent.When boththestudentandinstructoraresatisfiedwiththestudent’sproficiency,thestudentwillperformstudies underindirect supervision to gain experience and expertise in MR imaging. This course is presented with a progression in competency levels in clinical performance objectives and competencyexams.Thestudentwillhaveaccesstothefacilities,personnel,examinations,andeducational materials to achieve the course objectives competently. MR201–SectionalAnatomyII–24ClockHours/2QuarterCreditHours Prerequisite: None This course studies human anatomy in axial, sagittal, and coronal planes. Other imaging planes are studied whenrelevantfordemonstratinganatomyinspecificregions.CorrelationtoMRIispracticedinthiscourse. Bony, muscular, vascular, organs, and soft tissues of the following anatomical regions are studied: the central nervoussystem(brainandspine),otherstructuresinthehead,softtissueneck,musculoskeletal, cardiovascular, thorax, abdomen, and pelvis. MR202–MedicalTerminologyII–18ClockHours/1.5QuarterCreditHours Prerequisite: None This course introduces the student to medical and pathological terms related to specific body systems. Through lectures, discussions, demonstrations, visual aids, and self-study, the student will develop knowledge and understandingoftheprofessionallanguagetofunctionandcommunicateeffectivelywithothermedicalteam members. MR203–MRIProtocolsandProceduresI–42ClockHours/4QuarterCreditHours Prerequisite: None This course provides students with imaging techniques for the CNS, neck, thorax, musculoskeletal system, and abdominopelvicregions.Studentswilllearnthespecific clinical application, available coils, their use, considerations in the scan sequences, specific protocol choices (i.e., slice thickness, phase direction, flow compensation), and positioning criteria. Anatomicalstructures, the plane that best demonstrates anatomy, and signal characteristics of normal and abnormalstructureswill be discussed. Pharmacology, as it pertains to MRI, will be discussed. MR204–MRISafety–36ClockHours/3.5QuarterCreditHours Prerequisite: None This course introduces the basic principles of MR safety and covers the basic concepts of patient management. Educating patients and ancillary staff on magnet safety is also presented. Patient and magnet-related 276

emergenciesrepresentauniquesituationforanMRtechnologist.Therecommendedproceduresand responsibilities of the technologist will be discussed in these situations. This content also covers MR contrast agents. This introduction provides basic knowledge of MR safety, patient preparation, and monitoring of patients in the MRsuite.Thisinformationenablesthestudenttocommunicatebetterwiththehealthcareteamtoensure patients’ safety. Health effects and safety issues are important aspects of this diagnostic modality. MR211–MRIClinicalII–252ClockHours/8QuarterCreditHours Prerequisite: None This course allows students to practice the skills necessary to obtain high-quality MR images, objectively alter protocols based on patient pathology or physical condition, identify image quality problems, and make appropriate corrections. The clinical is conducted at a clinical facility after or with didactic instruction. Activities include demonstration and observation, after which the student assists in performing the activity. Thestudentcanperformtheactivityunderdirectsupervisionwhensatisfactoryproficiencyisapparent.When boththestudentandinstructoraresatisfiedwiththestudent’sproficiency,thestudentwillperformstudies underindirect supervision to gain experience and expertise in MR imaging. This course is presented with a progression in competency levels in clinical performance objectives and competencyexams.Thestudentwillhaveaccesstothefacilities,personnel,examinations,andeducational materials to achieve the course objectives competently. MR301–SectionalAnatomyIII–24ClockHours/2QuarterCreditHours Prerequisite: None This course studies human anatomy in axial, sagittal, and coronal planes. Other imaging planes are studied whenrelevantfordemonstratinganatomyinspecificregions.CorrelationtoMRIispracticedinthiscourse. Bony, muscular, vascular, organs, and soft tissues of the following anatomical regions are studied: the central nervoussystem(brainandspine),otherstructuresinthehead,softtissueneck,musculoskeletal, cardiovascular, thorax, abdomen, and pelvis. MR302–PhysicsI–31ClockHours/3QuarterCreditHours Prerequisite: None This course provides a comprehensive overview of MR imaging. Topics include instrumentation, magnetism, NMRsignalproduction,tissuecharacteristics, spatial localization, pulse sequencing, imaging parameters/options, special applications, safety, and quality assurance. Advanced-level training is included, whichprovidesactivities related to physical principles and quality assurance procedures. MR303–MRIProtocolsandProceduresII–42ClockHours/4QuarterCreditHours Prerequisite: None This course provides the student with imaging techniques related to the CNS, neck, thorax, musculoskeletal system, and abdominopelvic regions. Students will learn the specific clinical application, available coils, their use, considerations in the scan sequences, specific protocol choices (i.e., slice thickness, phase direction, flow compensation), and positioning criteria. Anatomicalstructures, the plane that best demonstrates anatomy, and signal characteristics of normal and abnormalstructureswill be discussed. The pharmacology of MRI will be discussed. MR304–MRIPathologyinDiagnosticImaging–36ClockHours/3.5QuarterCreditHours Prerequisite: None This course familiarizes students with the common pathologies in magnetic resonance imaging and their appearanceswithvariousimagingprotocols.Thecoursecontentwillincludeallcommonlyimagedbody 277

systemsandareas.Thestudentswillusecasestudiesandimagesofthepathologiestoreinforcethelectures fromcasestheyperformedorobservedduringclinicalexternships.Thestudentwillresearchpathologiesand present the research in class. MR311–MRIClinicalIII–252ClockHours/8QuarterCreditHours Prerequisite: None This course allows students to practice the skills necessary to obtain high-quality MR images, objectively alter protocols based on patient pathology or physical condition, identify image quality problems, and make appropriate corrections. The clinical is conducted at a clinical facility after or with didactic instruction. Activities include demonstration and observation, after which the student assists in performing the activity. Thestudentcanperformtheactivityunderdirectsupervisionwhensatisfactoryproficiencyisapparent.When thestudentandinstructoraresatisfied with the student’s proficiency, the student will perform studies under indirect supervision to gain experience and expertise in MR imaging. This course is presented with a progression in competency levels in clinical performance objectives and competencyexams.Thestudentwillhaveaccesstothefacilities,personnel,examinations,andeducational materials to achieve the course objectives competently. MR401–MedicolegalConsiderationsinHealthcare–24ClockHours/2QuarterCreditHours Prerequisite: None This course provides a fundamental background in ethics and human diversity. The historical and philosophical basis of ethics and the elements of ethical behavior will be discussed. The student will examine various ethical issues and dilemmas found in clinical practice. Courseactivities will include research and analysis on case studies germane to medical imaging. An introduction to legal terminology, concepts, and principles will also be presented. Topics include misconduct, malpractice, legal, and the A.S. IN RT professional standards. MR402–MRIRegistryReview–36ClockHours/3.5QuarterCreditHours Prerequisite: None This course prepares students to pass the required registry board exams to work as MRI Technologists. This course reviews the MRI program. Students will take mock registry board exams. Students will learn effective waystostudyandanswerquestionsfromtheregistry. MR403–PhysicsII–31ClockHours/3QuarterCreditHours Prerequisite: None This course provides a comprehensive overview of MR imaging. Topics include instrumentation, magnetism, NMRsignalproduction,tissuecharacteristics, spatial localization, pulse sequencing, imaging parameters/options, special applications, safety, and quality assurance. Advanced-level training is included, whichprovidesactivities related to physical principles and quality assurance procedures. MR404–ComputersinImagingandPACS–24ClockHours/2QuarterCreditHours Prerequisite: None This course gives the student an understanding of radiology’s components, principles, and operation of digital imagingsystems.Thestudentwilllearntheprinciplesofdigitalimagingsystemsandfactorsthatimpactimage acquisition, display, archiving, and retrieval of MR images. MR411–MRIClinicalIV–252ClockHours/8QuarterCreditHours Prerequisite: None 278

This course allows students to practice the skills to obtain high-quality MR images, objectively alter protocols basedonpatientpathologyorphysicalcondition,identifyimagequalityproblems,andmakeappropriate corrections. The clinical is conducted at a clinical facility after or with didactic instruction. Activities include demonstration and observation, after which the student assists in performing the activity. Thestudentcanperformtheactivityunderdirectsupervisionwhensatisfactoryproficiencyisapparent.When boththestudentandinstructoraresatisfiedwiththestudent’sproficiency,thestudentwillperformstudies underindirect supervision to gain experience and expertise in MR imaging. This course is presented with a progression in competency levels in clinical performance objectives and competencyexams.Thestudentwillhaveaccesstothefacilities,personnel,examinations,andeducational materials to achieve the course objectives competently. Associate of Science in Nuclear Medicine Technology (A.S. in NM) Courses – Blended, Full Distance Education Program NM111–PatientCareinNuclearMedicine–100ClockHours/8QuarterCreditHours Prerequisite: None Thecourseprovidesanoverviewofthetechnologist’sroleinthehealthcaresystem.Patientcareprinciplesand practices, including ECG monitoring, vital signs, blood collection, aseptic technique, and infection control, will bediscussed. Contentprovidesconceptsofpatienteducationandconsiderationsforthephysicalandpsychologicalneedsof thepatient and their family members. An overview of the healthcare system outlines the structure and functions of various departments within the hospital and outpatient setting. NM112–IntroductiontotheScienceofNuclearMedicine–100ClockHours/10QuarterCreditHours Prerequisite: None Thecoursewillgivethestudentanoverviewofnuclearmedicinedepartmentoperationsandprocedures. Students will explore diagnostic and therapeutic procedures focusing on clinical indications and radiopharmaceutical selection. Nuclear pharmacyconcepts,gammacameras,positronemissiontomography(PET),andhybridimaging equipmentwillbeintroduced.Anoverviewofnuclearmedicineclinicalresearchandhealthinformaticswillbe explored. NM121–RadiationProtection&Biology–75ClockHours/7.5QuarterCreditHours Prerequisite: Completion of module I with a “C” or better. Thecourseprovidesanoverviewoftheprinciplesofradiationprotection,thetechnologist’sresponsibilities for patients and the public, and radiation health and safety requirements of federal and state regulatory agencies, accreditation agencies, and medical organizations. Anoverviewoftheprinciplesofradiationinteractionswithmolecules,cells, tissues, and the body and the factors affecting biological response are presented, including acute and chronic effects of radiation. The managementofaradiationsafetyprogramandregulationswillbediscussed. NM122–InstrumentationinNuclearMedicineI–80ClockHours/8QuarterCreditHours Prerequisite: Completion of module I with a “C” or better. Thecourseprovidesstudentswithimagingandnon-imaginginstrumentationprinciplesinnuclearmedicine. Thecoursefocusesonthefunction,design,andqualitycontrolpracticesforgas-filledandscintillation detectors, pulse-height analyzers, spectrometers, and counting systems. The course will discuss the componentsofscintillation camera systems. Nuclear counting statistics will be introduced. 279

NM123–NuclearPhysics–60ClockHours/6QuarterCreditHours Prerequisite: Completion of module I with a “C” or better. Thecourseprovidesgeneralnuclearphysics,atomicstructure,andradiationconcepts.Thecontentincludes information about modes of radioactive decay, radionuclide and radiopharmaceutical production, interactions of radiation with matter, and radiation units and quantities. Decay factors, half-life, and activity calculations will beperformed. NM131–NuclearProceduresI–95ClockHours/8.5QuarterCreditHours Prerequisite: Completion of module II with a “C” or better. Thecourseprovidesaknowledgebaseindiagnosticnuclearmedicineprocedures.Thecoursewilldiscuss anatomy,physiology, and pathology for various body systems and how those concepts apply to nuclear medicineprocedures.Studentswilllearntheradiopharmaceuticals,medications,andmechanismofactionfor eachprocedureandtheircontraindications.SPECTandPETimagingtoolswillbeintroduced. NM132–InstrumentationinNuclearMedicineII–75ClockHours/7.5QuarterCreditHours Prerequisite: Completion of module II with a “C” or better. Thecourseprovidesstudentswithprinciplesofimaginginstrumentationusedinnuclearmedicine.Thecourse focuses on the function, design, and quality control practices for gamma cameras, positron emission tomography(PET),singlephotonemissioncomputedtomography(SPECT),andhybridimagingequipment. Digital imaging quality, processing, and reconstruction will be discussed. NM141–NuclearProceduresII–60ClockHours/6QuarterCreditHours Prerequisite: Completion of module III with a “C” or better. Thecourseprovidesaknowledgebaseindiagnosticandtherapeuticnuclearmedicineprocedures.Thecourse will discuss anatomy, physiology, and pathology for various body systems and how they are imaged in nuclear medicine. Students will learn the radiopharmaceuticals, medications, and mechanism of action for each procedureandtheircontraindications. Nuclear medicine and PET/CT applications discuss tumor and infection imaging. NM142–NuclearPharmacy–60ClockHours/6QuarterCreditHours Prerequisite: Completion of module III with a “C” or better. Thecourseprovidesanoverviewoftheoperationsandregulationsofthenuclearpharmacy.Thecontent contains the study of major radiopharmaceuticals, production methods, characteristics, and uses in nuclear medicine. The course will discuss radiation regulations, radioactive waste management, radioactive spill emergencyresponse,andspecialprocedureswithinradiopharmacy.Studentswillcompleteaproject demonstratingknowledgeofnuclearpharmacyoperationsandpractices. NM143–PrinciplesofCTinNuclearMedicine–70ClockHours/7QuarterCreditHours Prerequisite: Completion of module III with a “C” or better. Thecourseprovidesstudentswithcomputedtomography(CT)imagingprinciples.Thiscourseprovidesan overviewofCTequipment,applications,qualitycontrol,injection techniques, image post-processing, and reconstruction basics. Students will learn the basic scanning parameters of the adult patient. NM250C–ClinicalPracticeI–128ClockHours/4QuarterCreditHours Prerequisite: Completion of module IV with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of diagnostic andtherapeuticnuclearmedicineimagingprocedures,andtotalqualitymanagement.Teampractice, patient-centered clinical practice, and professional development are evaluated through structured, competency-basedclinical assignments. Competency levels ensure the patient’s well-being before, during, and following the imaging procedure. 280

NM251–Cross-SectionalAnatomy–48ClockHours/4.5QuarterCreditHours Prerequisite: Completion of module IV with a “C” or better. Thecourseprovidesentry-levelnuclearmedicinestudentswithprinciplesrelatedtosectionalanatomy.Course content will provide an overview of the body’s transverse, coronal, oblique, and sagittal sectional anatomy. Anatomicallandmarksandnormalversusabnormalanatomyandpathologicalprocesseswillbereviewed. Correlations between 3D, CT, MRI, and PET images are explored. NM252–PrinciplesofPETinNuclearMedicine–60ClockHours/QuarterCreditHours Prerequisite: Completion of module IV with a “C” or better. Thecourseprovidesstudentswithprinciplesrelatedtopositronemissiontomography(PET)andhybridimaging techniques in computed tomography(CT)andmagneticresonanceimaging(MRI).Thiscourseprovidesan overviewofPETradionuclideproduction,physics,instrumentation,andimagefusion.Studentswilllearnthe oncologic, neurologic, and cardiac applications of PET imaging. NM253–Pharmacology,DrugAdministration,andVenipuncture–54ClockHours/4.5QuarterCreditHours Prerequisite: Completion of module IV with a “C” or better. BLS class completion with current certification. Thecourseprovidesbasicconceptsofpharmacology,venipuncturetechniques,andadministeringdiagnostic contrast agents and intravenous medications. Students will recognize patient and scenario-specific risks, medicationprecautions, and contraindications. Preparation and monitoring techniques for medication administration are emphasized. Students will perform venipuncture on a virtual simulator. NM260C–ClinicalPracticeII–360ClockHours/12QuarterCreditHours Prerequisite: Completion of module V with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of diagnostic andtherapeuticnuclearmedicineimagingprocedures,andtotalqualitymanagement.Teampractice, patient-centered clinical practice, and professional development are evaluated through structured, competency-basedclinical assignments. Competency levels ensure the patient’s well-being before, during, and following the imaging procedure. NM270C–ClinicalPracticeIII–384ClockHours/12.5QuarterCreditHours Prerequisite: Completion of module VI with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of diagnostic andtherapeuticnuclearmedicineimagingprocedures,andtotalqualitymanagement.Teampractice, patient-centered clinical practice, and professional development are evaluated through structured, competency-basedclinical assignments. Competency levels ensure the patient’s well-being before, during, and following the imaging procedure. NM271–NuclearProceduresIII–36ClockHours/3.5QuarterCreditHours Prerequisite: Completion of module VI with a “C” or better. The course reviews the program’s core curriculum to prepare students to study for and pass the national credentialing examination. Content will cover the registry content specifications, including patient care and procedures. Students will take mock registry board exams and learn effective studying strategies. NM280C–ClinicalPracticeIV–360ClockHours/12QuarterCreditHours Prerequisite: Completion of module VII with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of diagnostic andtherapeuticnuclearmedicineimagingprocedures,andtotalqualitymanagement.Teampractice, patient-centered clinical practice, and professional development are evaluated through structured, competency-basedclinical assignments. Competency levels ensure the patient’s well-being before, during, and following the imaging procedure. NM281–NuclearMedicineCapstone–36ClockHours/3.5QuarterCreditHours 281

Prerequisite: Completion of module VII with a “C” or better. The course reviews the program’s core curriculum to prepare students to study for and pass the national credentialing examination. Content will cover the registry content specifications, including safety and image production. Students will take mock registry board exams and learn effective studying strategies. Associate of Science in Nursing (ADN) Courses – Blended Program RN100–FundamentalsofNursingTheory–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 101. Failure in one paired course equals failure in both paired courses. This course introduces professional nursing. Content includes a brief history of nursing, including the roles and responsibilities of the health care team. The provision of a standard of care consistent with legal, ethical, and regulatory guidelines and ANA Standards of Practice are emphasized. Verbal communication skills, informatics, evidence-based practice, safety, and developing a patient-centered therapeutic nurse-client relationship are fostered. Students are taught the nursing process and nursing diagnosis to develop a nursing care plan. RN101–FundamentalsofNursingClinicalandLab–157.5ClockHours/3.5SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 100. Failure in one paired course equals failure in both paired courses. This course integrates concepts, theories, and skills fundamental to nursing practice. Students will use the nursing process to plan and provide for adult patients’ cultural, physiological, social, psychological, and spiritual needswithhealthdisruptions. RN102–HealthAssessmentTheory–30ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 103. Failure in one paired course equals failure in both paired courses. This course focuses on strategies to obtain health histories and physical assessment data for diverse populations across the lifespan. Students are instructed to identify normal and abnormal findings using inspection, palpation, percussion, and auscultation. Health risk prevention and the promotion of optimal health behaviors are also addressed. RN103–HealthAssessmentSkillsLab–67.5ClockHours/1.5SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 102. Failure in one paired course equals failure in both paired courses. This course uses health assessment theory to develop the hands-on skills of inspection, palpation, percussion, andauscultation. Laboratory experience includes demonstration, practice, and critique of skill performance. RN104–FundamentalsofPharmacology–30ClockHours/2SemesterCreditHours Prerequisite: None Students are familiarized with a history of pharmacology, the classification of medications, their actions, application, and nursing considerations. Principles and procedures for the safe administration of medications are stressed. Basic math and computation of adult and pediatric dosages are included. Actions, interactions, applications, and nursing considerations are addressed. RN106–Pathophysiology–30ClockHours/2SemesterCreditHours Prerequisite: None Pathophysiological changes in acutely ill and chronically ill patients across the lifespan are explored using a systemsandinter-systemsapproach.Identification of pathological changes in assessing patients with major health disruptions; techniques appropriate to patients using a major systems approach; analysis of data and describing intersystem relationships across the life span as a basis for problem-solving in the nursing process. 282

Students are introduced to how genomics offers new possibilities for therapies and treatments for some complexdiseasesandnewdiagnosticmethods.BasicEKGandarrhythmiadeterminationandABGanalysisare included. RN180–NursingTransitionAdvancedPlacementTheory&LabCourse–120ClockHours/5SemesterCredit Hours Prerequisite: None This course introduces students to the roles and responsibilities of the registered nurse and the Associate DegreeNursingProgramframework.Emphasisisplacedonvariousrolesoftheregisterednurse,legaland ethical responsibilities, nursing process, critical thinking, and evidence-based practice, delivering competent care to diverse demographics of multicultural clients throughout the lifespan. Lecture contents include the role of the registered nurse and the care of adult, maternity, and pediatric clients. Thelabcomponentofthiscoursefocusesonutilizingthenursingprocess,criticalthinking,andapplyingtheory to skills in various patient case scenarios. Thefollowingskills competencies focused on in this course: dosage calculation, assessment, intravenous administrations, central venous access, medication administration, nasogastric feeding, foley catheter insertion, tracheostomycare,andsuctioning. RN200–Medical/SurgicalITheory–IntroductiontoMed/Surg–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 201. Failure in one paired course equals failure in both paired courses. This course provides basic medical/surgical theory related to endocrine, musculoskeletal, integumentary, and sensory system disorders, perioperative care, and fluid and electrolyte imbalances. Develop an understanding of the dynamic sequence of biological, psychological, and sociological changes in older adulthood. Usual growth and development patterns and disruption in critical periods of development are presentedandhelpthedevelopmentofnursinginsightthatwillenablesafe,effective,patient-centeredcare. RN201–Medical/SurgicalIClinical–IntroductiontoMed/Surg–90ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 200. Failure in one paired course equals failure in both paired courses. This course applies the theoretical content of patient-centered care of patients with medical-surgical conditions. Emphasis is on care planning, assessment, teaching, and clinical interventions to promote healthy outcomesforpatients. RN202–Medical/SurgicalIITheory–IntermediateMed/Surg–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 203. Failure in one paired course equals failure in both paired courses. This course provides basic medical/surgical theory related to endocrine, gastrointestinal, genitourinary, and hematology problems in cancer patients and palliative care. Develop an understanding of the dynamic sequence of biological, psychological, and sociological changes in older adulthood. Usual growth and development patterns and disruption in critical periods of development are presented and help the developmentofnursinginsightthatwillenablesafe,effective, patient-centered care. RN203–Medical/SurgicalIIClinical–IntermediateMed/Surg–90ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 202. Failure in one paired course equals failure in both paired courses. This course applies the theoretical content of patient-centered care of patients with medical-surgical conditions. Emphasis is on care planning, assessment, teaching, and clinical interventions to promote healthy outcomesforpatients. 283

RN300–MaternalNewbornTheory–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 301. Failure in one paired course equals failure in both paired courses. The course covers comprehensive maternal and newborn care, beginning with preconception planning and including risks in pregnancy and postpartum, maternal and newborn complications, male and female reproductive problems and needs, and family needs and problems during the maternity cycle. Concepts of nutrition, cultural variations, and the safety of mothers and newborns are integrated. Therapeutic use of drugs during pregnancy, labor and delivery, and the immediate postpartum period are included. RN301–MaternalNewbornClinical–67.5ClockHours/1.5SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 300. Failure in one paired course equals failure in both paired courses. This course is taught at a clinical site, applying the theoretical content of patient-centered care of mothers and newborns. The emphasis is on assessment, teaching, and clinical interventions to promote healthy outcomes for families. RN302–CareofChildrenTheory–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 303. Failure in one paired course equals failure in both paired courses. This course covers in-depth identification of various diseases affecting the child through young adulthood, including physical and developmental maturation. Cultural variations and family interactions are explored. Disease prevention, health maintenance, and appropriate therapeutic interventions such as pharmacologic agents and nutrition are included. RN303–CareofChildrenClinical–67.5ClockHours/1.5SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 302. Failure in one paired course equals failure in both paired courses. This course is taught at a clinical site, applying the theoretical content into practice with attention to patient-centered, quality care. Interaction with family members facilitates the student’s ability to recognize family dynamics and their effects on the developmental process. Advanced skills necessary to care for pediatric patients are achieved through simulation. The application of the nursing process to optimize patient and family outcomesisemphasized. RN304–Medical/SurgicalIIITheory–AdvancedMed/Surg–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 305. Failure in one paired course equals failure in both paired courses. This course provides basic medical/surgical theory related to respiratory, cardiac, neurologic, and musculoskeletal disorders. Develop an understanding of the dynamic sequence of biological, psychological, and sociological changes in older adulthood. Usual growth and development patterns and disruption in critical periods of development are presented and help the development of nursing insight that will enable safe, effective, patient-centered care. RN305–Medical/SurgicalIIIClinical–AdvancedMed/Surg–90ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 304. Failure in one paired course equals failure in both paired courses. This course is taught at a clinical site, integrating the practical application of advanced medical/surgical theory to care for selected patients with multiple health disruptions. Students apply the nursing process to optimize patient outcomes. RN400–MentalHealthTheory–45ClockHours/3SemesterCreditHours Prerequisite: None 284

Corequisite: This course is paired with RN 401. Failure in one paired course equals failure in both paired courses. This course addresses theories and principles of psychiatric nursing. Biopsychosocial foundations of behavior, communication, and psychopharmacology are emphasized. Patient relationships and the use of effective and ineffective communication are addressed. The course studies the nurse’s role in the prevention and early identification of psychiatric disorders of children, adolescents, adults, and older adults and the treatment modalities of mental illness and organic brain syndromes. RN401–MentalHealthClinical–90ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 400. Failure in one paired course equals failure in both paired courses. This course is taught at clinical sites, applying theory into clinical practice in the care of selected patients who may experience psychological stress, neurobiological disorders, and high-risk situations such as homelessness, family violence, child abuse, HIV, and post-traumatic stress syndrome. Students apply the nursing process to optimize patient outcomes. RN402–Medical/Surgical IV Theory – Complex Med/Surg & Leadership –45ClockHours/3SemesterCredit Hours Prerequisite: None Corequisite: This course is paired with RN 403. Failure in one paired course equals failure in both paired courses. This course incorporates previous medical-surgical nursing theory emphasizing the integration of pathophysiology, nutrition, pharmacology, and psychosocial components of safe and individualized care for patients with complex medical-surgical health disruptions. Focus on holistic care for burns, heart failure, acute respiratory distress, shock, multiple organ dysfunction, and traumatic brain injury. Leadership and management in nursing are explored as they relate to managing complex medical-surgical health alterations. RN403–Medical/Surgical IV Clinical – Complex Med/Surg & Leadership–90ClockHours/2SemesterCredit Hours Prerequisite: None Corequisite: This course is paired with RN 402. Failure in one paired course equals failure in both paired courses. This course is taught at a clinical site, integrating the practical application of advanced medical/surgical theory to care for selected patients with multiple health disruptions. Students apply the nursing process to optimize patient outcomes. Associate of Science in Physical Therapy Assistant (A.S. in PTA) Courses – Blended Program PTA100–IntroductiontoPhysicalTherapistAssistant–22ClockHours/2QuarterCreditHours Prerequisite: None This course introduces the Physical Therapist Assistant’s role and scope of practice. Emphasis will be on educational preparation, a historical overview of physical therapy in the healthcare system, professional affiliations, structure and function of physical therapy services, ethical and legal issues in healthcare, documentation,andcommunication.Thiscoursealsoincludesanintroductiontoaself-studyprogramin medicalterminologyandHIPAAregulationstraining. PTA110–FundamentalPTAprocedureswithlab–77ClockHours/4.5QuarterCreditHours Prerequisite: None This course begins with patient handling skills and the continuation of documentation. Students practice and developskills in gathering data for documentation necessary for assessing patient response to physical therapy while under the direction and supervision of a physical therapist. Students will acquire skills in data collection, tests and measurements, patient handling, assistive devices, guarding, transfers, and range of motion. PTA120–ClinicalKinesiologywithlab–77ClockHours/4.5QuarterCreditHours Prerequisite: None 285

This course provides knowledge of the principles of mechanics and musculoskeletal anatomy and how they relate to human motion and the field of physical therapy. The concepts of locomotion, forces, and levers are introduced. Topics include muscle origins, insertions, and actions. Laboratory experiences correlate to the lectures and include manual muscle testing and goniometry. Students will be expected to achieve competency on a given list of skills. Part 1 covers the lower extremity. Part II covers theupperextremity. This course is aligned by a body system with PTA 220. PTA130–Pathology–44ClockHours/4QuarterCreditHours Prerequisite: None This course provides knowledge of disease processes, systemic disorders, guidelines, precautions, and contraindications for physical therapy interventions. PTA210–ProceduresIIwithlab–66ClockHours/4QuarterCreditHours Prerequisite: Completion of Term 1 with “C” or better. This course introduces the use and application of physical agents, soft tissue interventions, and electrotherapies in physical therapy. The practice of treatment techniques is emphasized through laboratory time. Students will beexpectedtoachievecompetencyonagivenlistofskills. PTA220–OrthopedicManagement–66ClockHours/4QuarterCreditHours Prerequisite: Completion of Term 1 with “C” or better. This course prepares the PTA student to address orthopedic-related conditions commonly seen in Physical Therapy. Basic exercise principles and their application are covered with laboratory discussion, demonstration, andpractice. Students will be expected to achieve competency on a given list of skills. Part 1 covers the lower extremity, and Part II covers the upper extremity. This course is aligned by a body system with PTA 120. PTA222–PatientCareSkillsI–22ClockHours/1QuarterCreditHour Prerequisite: Completion of Term 1 with “C” or better. This lab course emphasizes the practical combination of patient pathologies covered in concurrent and previous courses. Students develop interventions from case scenarios and plans of care. Group participation and student-to-student assistance fostering communication and independence are encouraged to prepare for the comingclinical experience. Students develop clinical problem-solving skills in orthopedic conditions, modalities, patient handling, therapeutic exercise, and other pathologies presented. Students will be expected to achieve competencyonagivenlistofskills. PTA225–ClinicalEducationI–184ClockHours/6QuarterCreditHours Prerequisite: Completion of Term 2 didactic coursework with “C” or better. This is the first integrated clinical experience allowing students to further their exposure to physical therapy practice in the clinical environment and apply those skills that the student has tested proficient in before the clinical experience and that the Clinical Instructor deems appropriate. Students will be at the clinical facility full-time for four (4) weeks and three (3) days. PTA226–ClinicalEducationISeminar–11ClockHours/1QuarterCreditHour Prerequisite: Completion of PTA 225 with “Pass.” This course includes case study presentations and reviewing the first full-time clinical experience, including billing, reimbursement, and discharge planning. PTA230–ProfessionalBehaviors–33ClockHours/3QuarterCreditHours Prerequisite: Completion of Term 1 with “C” or better. This course introduces the concept of a multicultural society and how it plays an increased role in the physical therapy clinic. Topics include communication skills, the psychology of disability, health disparities between populations, age differences, ethics and values, and professional development within the healthcare system. 286

PTA233–PatientCareSkillsII–22ClockHours/1QuarterCreditHour Prerequisite: Completion of PTA 226 with “C” or better. This lab course addresses the more complex patient. Case scenarios are used for students to develop skills in applying interventions following the Plan of Care of the supervising physical therapist. Concentration is on the progression and regression of exercises responding to patient performance. Casestudieswill demonstrate the PT/PTA relationship and the PTA’s responsibility for the Plan of Care. Group participation and student-to-student assistance fostering communication and independence are encouraged to prepareforthecomingclinicalexperience. PTA235–ClinicalEducationII–240ClockHours/8QuarterCreditHours Prerequisite: Completion of Term 3 didactic coursework with “C” or better. This is the second integrated clinical experience designed to allow the student to further their exposure to physical therapy practice in the clinical environment and apply those skills that the student has tested proficient in before the clinical experience and that the Clinical Instructor deems appropriate. Students will be at the clinical facility full-time for six (6) weeks. PTA240–AppliedNeurology–66ClockHours/4QuarterCreditHours Prerequisite: Completion of PTA 226 with “C” or better. This course builds on neurologically based disabilities commonly seen in physical therapy practice across the lifespan. Commontherapeuticinterventions for rehabilitation are practiced. The chronic nature of neurologic conditions and their effect on the individual’s life will be addressed as they affect the provision of physical therapy. Students will be expected to achieve competency on a given list of skills. PTA245–ClinicalEducationIII–280ClockHours/9QuarterCreditHours Prerequisite: Completion of PTA 280 with “Pass.” This is the third and terminal clinical experience designed to allow the student to further their exposure to physical therapy practice in the clinical environment and apply those skills that the student has tested proficient in before the clinical experience and that the Clinical Instructor deems appropriate. Students will be at the clinical facility full-time for seven (7) weeks. PTA250–PhysicalTherapyAspectsofGrowth,Development,andAging–44ClockHours/3QuarterCredit Hours Prerequisite: Completion of PTA 226 with “C” or better. This course covers relevant topics and interventions that deal with delivering physical therapy services across thelifespan, including the aging population as a normal process and the common pathologies associated with aging. Emphasis is placed on Cardiovascular and Respiratory conditions, fall prevention, and wound care. PTA260–SelectedTopics–44ClockHours/3QuarterCreditHours Prerequisite: Completion of PTA 226 with “C” or better. This course consists of selected topics in physical therapy to complement prior coursework—required content in Prosthetics and genitourinary conditions. Additional clinical topics may include vestibular, chronic pain, taping, ergonomics, and other contemporary issues encountered in physical therapy delivery systems. PTA280–SeniorSeminar–33ClockHours/3QuarterCreditHours Prerequisite: Completion of PTA 235 with “Pass.” This course brings the PTA student’s educational and clinical experience full circle. Each student will demonstratethePTAasaneducatorbypresentingateachingunitrelatedtoanareaofinteresttopreparefor thein-service required during the final clinical experience. Students will explore the effective delivery of physical therapy services. Psychomotor, cognitive, affective, treatment approaches, communication, and documentationwillbediscussedregardingpatientcare. 287

Additional topics pertinent to an entry-level PTA will be presented. These include employment issues, continuedprofessional development, licensure application process, exam preparation strategies, and California PTPractice Acts and Rules and Regulations review. PTA290–LicensureExamPreparation–22ClockHours/2QuarterCreditHours Prerequisite: Completion of PTA 245 with “Pass.” This course reviews information and testing that will aid the student in preparing to take the NPTE for licensure as a PTA in California. A 16-hour workshop is facilitated by an outside educational company specializing in PTA exampreparation. Associate of Science in Radiologic Technology (A.S. in RT) Courses – Blended Program RT110C–ClinicalPracticeI–128ClockHours/4QuarterCreditHours Prerequisite: None Clinical experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Team practice, patient-centered clinical practice, and professional developmentareevaluatedthroughstructured,competency-basedclinicalassignments.Competencylevels ensurethepatient’s well-being before, during, and following the radiologic procedure. RT111–RadiologicPatientCare–42ClockHours/4QuarterCreditHours Prerequisite: None This course introduces students to basic imaging principles and patient care. Students review medical ethics, pediatrics, and geriatrics patient care. The duties and responsibilities of working in Radiology are also presented, emphasizing communication and relationships. A review of infection control and standard and transmission-based precautions is covered. RT112–RadiationPhysicsandExposure–58ClockHours/5QuarterCreditHours Prerequisite: None Thecourseisdesignedtoteachthenatureandcharacteristicsofradiation,x-rayproduction,andthe fundamentalsofphotoninteractionswithmatter.Contentprovidesbasicinformationabouttheintensityofthe X-ray beamandhowtechnicalfactorsinfluenceit. RT113–RadiographicProceduresI–48ClockHours/4.5QuarterCreditHours Prerequisite: None This course provides the knowledge base to perform standard imaging. Emphasis is on basic Thoracic Viscera, BonyThorax,UpperLimb,andShoulderGirdleimaging.Considerationwillbegiventotheproductionofimages of optimal diagnostic quality. Coursemethodswillincorporatelectures,demonstrations,imageanalyses,positioninglabpracticum,and self-paced study using multimedia programs. Students must demonstrate competency in positioning skills, equipmentmanipulation,andradiationprotectionbeforeperformingtheseskillsunderdirectsupervisionin thepatient care setting. RT113L–RadiographicProceduresILab–30ClockHours/1.5QuarterCreditHours Prerequisite: None Thecourseprovidestheknowledgetoperformstandardimagingoftherespiratorysystem,bonythorax,and upperextremities. Consideration will be given to the production of images of optimal diagnostic quality. Coursemethodswillincorporatedemonstrations,imageanalyses,andpositioninglabpracticum.Studentsmust demonstratecompetencyinpositioningskills, equipmentmanipulation,andradiationprotectionbefore performingtheseskills under direct supervision in the patient care setting. 288

RT120C–ClinicalPracticeII–168ClockHours/5.5QuarterCredits Prerequisite: Completion of Module I with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Team practice, patient-centered clinical practice, and professional developmentareevaluatedthroughstructured,competency-basedclinicalassignments.Competencylevels ensurethepatient’s well-being before, during, and following the radiologic procedure. RT121–RadiationProtectionandBiology–50ClockHours/5QuarterCreditHours Prerequisite: Completion of Module I with a “C” or better. ThecourseprovidesabasicunderstandingoftheprinciplesofRadiobiologyandradiation’sshort-termand long-term effects. This course discusses the effects of radiation at the molecular and cellular levels. In addition, this course provides a better understanding of radiation protection for patients and occupational workers in the healthcare field. This course describes dose management implementations and the design for radiation protection within radiology. The principles of radiation and dose limits are described to promote safe practices. RT122–DigitalImaging–52ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module I with a “C” or better. Thecourseprovidesabasicunderstandingofdiagnosticradiology’scomponents,principles,andoperationof digital imaging systems. Digital Processing, imaging capture, and technical considerations in digital imaging are discussed. Technical factors affecting radiographic quality are outlined and described for proper image analysis. In addition, this course introduces medical informatics and quality management. RT123–RadiographicProceduresII–48ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module I with a “C” or better. Thecourseprovidestheknowledgebasenecessarytoperformstandardimaging.Emphasisisonbasicimaging of the lower extremities, pelvis, hip, and vertebral column. Consideration will be given to the production of imagesofoptimaldiagnosticquality. Coursemethodswillincorporatelectures,demonstrations,imageanalyses,positioninglabpracticum,and self-paced study using multimedia programs. Students must demonstrate competency in positioning skills, equipmentmanipulation,andradiationprotectionbeforeperformingtheseskillsunderdirectsupervisionin thepatient care setting. RT123L–RadiographicProceduresIILab–30ClockHours/1.5QuarterCreditHours Prerequisite: Completion of Module I with a “C” or better. Thecourseprovidesaknowledgebaseforstandardbonypelvis,lowerextremities,andvertebralcolumn radiographic procedures. Consideration will be given to the production of images of optimal diagnostic quality. Coursemethodswillincorporatedemonstrations,imageanalyses,andpositioninglabpracticum.Studentswill berequiredtodemonstratecompetencyinpositioningskills,equipmentmanipulation,andradiationprotection before performing these skills under the direct supervision of the patient. RT130C–ClinicalPracticeII–176ClockHours/5.5QuarterCreditHours Prerequisite: Completion of Module II with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Team practice, patient-centered clinical practice, and professional developmentareevaluatedthroughstructured,competency-basedclinicalassignments.Competencylevels ensurethepatient’s well-being before, during, and following the radiologic procedure. RT131–RadiographicPhysicsIIandFluoroscopy–48ClockHours/4.5QuarterCreditHours 289

Prerequisite: Completion of Module II with a “C” or better. Thecourseprovidesbasicinformationaboutelectricity, magnetism, and electromagnetism and applies these principles to the X-ray circuit. In addition, it provides a knowledge base in radiographic, fluoroscopic, and mobileequipmentrequirements,function,anddesign.Thiscoursewillincludeoutside-of-schoolpreparation hourssuchasreadingandwritingassignments,practiceandpracticalapplicationassignments,andprojects.A minimumof25hoursofout-of-classworkwillbeassigned. RT132–EthicsandLawinRadiography–24ClockHours/2QuarterCreditHours Prerequisite: Completion of Module II with a “C” or better. Thecourseprovidesafundamentalmedicallaw,ethics,andhumandiversitybackground.Thehistoricaland philosophical basis of ethics and the elements of ethical behavior will be discussed. The student will examine various ethical issues and dilemmas found in clinical practice. Courseactivities will include research and analysis on case studies germane to medical imaging. An introduction to legal terminology, concepts, and principles will also be presented. Topics include misconduct, malpractice, legal, and the ASRT professional standards. RT133–RadiographicProceduresIII–45ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module II with a “C” or better. Contentisdesignedtoprovidetheknowledgebasenecessarytoperformstandardimaging.Emphasisison basic imaging of the Abdomen, Soft-Tissue Neck, Digestive System, and Urinary System. Consideration will be given to the production of images of optimal diagnostic quality. Coursemethodswillincorporatelectures,demonstrations,imageanalyses,positioninglabpracticum,and self-paced study using multimedia programs. Students must demonstrate competency in positioning skills, equipmentmanipulation,andradiationprotectionbeforeperformingtheseskillsundersupervisioninthe patient care setting. RT133L–RadiographicProceduresIIILab–33ClockHours/1.5QuarterCreditHours Prerequisite: Completion of Module II with a “C” or better. Thecourseprovidesaknowledgebasenecessarytoperformstandardradiographicproceduresofthe abdomen.Studentswillalsoreviewthebiliarysystem,genitourinarysystem,andgastrointestinaltract, and procedureswill be done using fluoroscopy and endoscopy. Consideration will be given to the production of imagesofoptimaldiagnosticquality. Coursemethodswillincorporatedemonstrations,imageanalyses,andpositioninglabpracticum.Studentsmust demonstratecompetencyinpositioningskills, equipmentmanipulation,andradiationprotectionbefore performingtheseskills under direct supervision in the patient care setting. RT140C–ClinicalPracticeIV–192ClockHours/6QuarterCreditHours Prerequisite: Completion of Module III with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Team practice, patient-centered clinical practice, and professional developmentareevaluatedthroughstructured,competency-basedclinicalassignments.Competencylevels ensurethepatient’s well-being before, during, and following the radiologic procedure. RT142–RadiographicPathology–48ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module III with a “C” or better. Thecourseprovidestheoriesofdiseasecausationandthepathophysiologicaldisordersthatcompromise healthy systems. Etiology, pathophysiological responses, clinical manifestations, radiographic appearance, and managementofalterationsinbodysystemswillbepresented.Studentswillberequiredtowritearesearch 290

papergermanetomedicalimaging.Theywillbeencouragedtosubmititforconsiderationintheannual student competition held by the American Society of Radiologic Technologists. RT143–RadiographicProceduresIV–45ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module III with a “C” or better. This course provides the knowledge base necessary to perform standard imaging. The emphasis is on basic imagingoftheCranium,TraumaRadiography,MobileRadiography,andSurgicalRadiography.Considerationwill begiventotheproductionofimagesofoptimaldiagnosticquality.Coursemethodswillincorporatelectures, demonstrations, image analyses, positioning lab practicum, and self-paced study using multimedia programs. Students must demonstratecompetencyinpositioningskills, equipment manipulation, and radiation protection before performing these skills under direct supervision in the patient care setting. RT143L–RadiographicProceduresIVLab–33ClockHours/1.5QuarterCreditHours Prerequisite: Completion of Module III with a “C” or better. Thecourseprovidesinformationnecessarytoperformradiographicproceduresofthecraniumandfacial bones,including sinuses, zygomatic arches, TMJs, orbits, and mandibles. Students will also demonstrate special techniques for trauma cases and mobile radiography. Consideration will be given to the production of images of optimal diagnostic quality. Coursemethodswillincorporatedemonstrations,imageanalyses,andpositioninglabpracticum.Studentsmust demonstratecompetencyinpositioningskills, equipmentmanipulation,andradiationprotectionbefore performingtheseskills under direct supervision in the patient care setting. RT250C–ClinicalPracticeV–280ClockHours/9QuarterCreditHours Prerequisite: Completion of Module IV with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Team practice, patient-centered clinical practice, and professional developmentareevaluatedthroughstructured,competency-basedclinicalassignments.Competencylevels ensurethepatient’s well-being before, during, and following the radiologic procedure. RT251–RadiographicPharmacologyandVenipuncture–36ClockHours/3QuarterCreditHours Prerequisite: Completion of Module IV with a “C” or better. The course provides basic concepts of pharmacology, techniques of venipuncture, and the administration of diagnostic contrast agents and intravenous medications. The appropriate delivery of patient care during these proceduresisemphasized.StudentswillperformvenipunctureonIVtrainingarmsandfellowstudents. RT252–Cross-SectionalAnatomy–40ClockHours/4QuarterCreditHours Prerequisite: Completion of Module V with a “C” or better. Thecourseprovidesradiographystudentswithprinciplesrelatedtosectionalanatomy.Thiscourseoverviews thehumanbody’stransverse,coronal,andsagittalsectionalanatomy.CorrelationsbetweenCT,MRI,and ultrasound are explored. RT260C–ClinicalPracticeVI–240ClockHours/8QuarterCreditHours Prerequisite: Completion of Module V with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Team practice, patient-centered clinical practice, and professional developmentareevaluatedthroughstructured,competency-basedclinicalassignments.Competencylevels ensurethepatient’s well-being before, during, and following the radiologic procedure. RT261–AdvancedDigitalImaging–30ClockHours/3QuarterCreditHours Prerequisite: Completion of Module V with a “C” or better. 291

Thecourseexplainsthecomponents,principles,andoperationofdigitalimagingsystemsfoundindiagnostic radiology. Factors that impact image acquisition, display, archiving, and retrieval are discussed. Guidelines for selecting exposure factors and evaluating images within a digital system assist students in connecting film-based and digital imaging systems. Principles of digital system quality assurance and maintenancearepresented. RT262–RadiographicAdvancedProcedures–48ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module V with a “C” or better. This course provides entry-level radiography students with principles related to contrast arthrography, pediatric andgeriatric, mammography,bonedensitometry,computedtomography,magneticresonanceimaging, vascular, cardiac, and interventional radiography. The course also introduces diagnostic medical sonography, nuclear and molecular imaging, and radiation oncology principles. RT270C–ClinicalPracticeVII–264ClockHours/8.5QuarterCreditHours Prerequisite: Completion of Module VI with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Team practice, patient-centered clinical practice, and professional developmentareevaluatedthroughstructured,competency-basedclinicalassignments.Competencylevels ensurethepatient’s well-being before, during, and following the radiologic procedure. RT271–PatientCareandProceduresSeminar–48ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module VI with a “C” or better. The course reviews patient care and procedures to prepare students for the ARRT® radiographer primary certification and State of California Department of Public Health, Radiologic Health Branch certification examinations. This course will review patient care topics such as sterile technique, medical-legal, imaging procedures, and image analysis. RT272–ComputedTomography–40ClockHours/4QuarterCreditHours Prerequisite: Completion of Module V with a “C” or better. Thecourseprovidesradiographystudentswithcomputedtomography(CT)imagingprinciples.Specialemphasis is placed on studying the head, brain, thorax, abdomen, pelvis, shoulder, elbow, hip, and knee. Correlations between cadaver cross-sections, CTs, MRIs, and radiographs are explored. CT Basics: The Series by ASRT utilized with the course satisfies the ARRT® 16-credit Structured Education Requirements for CT. RT273–Mammography–40ClockHours/4QuarterCreditHours Prerequisite: Completion of Module V with a “C” or better. Thecourseprovidesradiographystudentswiththeprinciplesrelatedtomammography.Topicsincludepatient care, anatomy and physiology of the breast, positioning for routine and diagnostic exams, pathology, mammographyequipment,qualitycontrol,andqualityassurancefordigitalimagingsystems. RT274–AdvancedRadiationProtection–50ClockHours/4QuarterCreditHours Prerequisite: Completion of Module VI with a “C” or better. Thecourseprovidesanoverviewoftheprinciplesofradiationprotection,theresponsibilitiesofthe radiographer for patients, personnel, and the public, and the radiation health and safety requirements of federal and state regulatory agencies, accreditation agencies, and medical organizations. An overview of the principles of interaction of radiation with molecules, cells, tissues, and the body as a whole and the factors affecting biological response are presented, including acute and chronic effects of radiation. RT280C–ClinicalPracticeVIII – 280 Clock Hours/9 Quarter Credit Hours Prerequisite: Completion of Module VII with a “C” or better. 292

Clinical experiences are designed to provide patient care and assessment, competent performance of radiologic imaging, and total quality management. Team practice, patient-centered clinical practice, and professional developmentareevaluatedthroughstructured,competency-basedclinicalassignments.Competencylevels ensurethepatient’s well-being before, during, and following the radiologic procedure. RT281–ImageProductionandSafetySeminar–48ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module VII with a “C” or better. The course reviews the radiologic technology curriculum and prepares students for the ARRT® radiographer’s primary certification and State of California Department of Public Health, Radiologic Health Branch fluoroscopy certification requirements. This course will focus on image production and radiation safety. RT282–ProfessionalDevelopmentandAdvancement–18ClockHours/1.5QuarterCreditHours Prerequisite: Completion of Module VII with a “C” or better. The course prepares students for the post-education transition into the workforce. The course guides students in developing documents that include resume writing skills, developing and practicing effective interviewing skills, and techniques for job search strategies. Students will prepare and apply for the ARRT® and California DepartmentofPublicHealthregistriestoobtaincertification as a radiographer. B.S. in Diagnostic Medical Imaging (B.S. in DMI) Courses – Distance Education (Online) Program DMI330–AdvancedRadiobiology–60ClockHours/4SemesterCreditHours Prerequisite: None This course will provide the radiologic science professional with theories and principles of the interaction of ionizing radiation with living systems. Radiation effects on biological molecules & organisms and factors affecting biological response are explored. Acute and long-term effects of ionizing radiation exposure are discussed. Applications in diagnostic and therapeutic settings are presented. DMI340–QualityControlinDiagnosticImaging–60ClockHours/4SemesterCreditHours Prerequisite: None Training and managing image quality and patient dose will be presented on film screens and digital radiology systems. This course will introduce new regulations and discuss new challenges for practitioners. Radiographers will learn to integrate and maintain the department’s imaging capability and radiation dose management. Quality control will be discussed in-depth, including procedures and protocols, visualization, transmission, and archiving of the images. DMI360–HealthScienceManagement–60ClockHours/4SemesterCreditHours Prerequisite: None This course provides entry-level managers with various tools and theories from which to choose. A marked focus is offered on the evaluation and resolution of personnel issues. An emphasis is placed on the ultimate responsibility of supervisors and managers for the performance of their staff. The text provides information and guidancetoobtainmaximumresultsfromothers.Gettingthingsdonethroughpeopleisakeycomponentof this text. DMI370–ProfessionalCapstonePortfolioProject–45ClockHours/3SemesterCreditHours Prerequisite: None This is an independent study project where students will prepare a professional E-portfolio. This portfolio is to beworkedonbytheBSDMIstudentsthroughouttheprogram,startingfromtheirfirstsemesteruntil completionoftheBSDMIprogram.Itcomprisesmanyindividualprojectsanddocumentspreparingthestudent for professional practice as an imaging professional with a Bachelor of Science in Diagnostic Medical Imaging. DMI410–LeadershipandPerformance–45ClockHours/3SemesterCreditHours Prerequisite: None 293

Leadership and performance are dynamic explorations of the Universal Laws of Performance and how to apply thempersonallyortoanyorganization.Usedbynotablebusinessesworldwide,theselawsopendoorsto discover and create cultures within a company that will alter the course of any organization. This course guides youindiscoveringtheuniversallawsandhowtoapplythemusingcasestudiesofthree(3)organizations. DMI420–OperationsandHumanResourceManagementinDiagnosticImaging–45ClockHours/3Semester Credit Hours Prerequisite: None This course focuses on various issues, including applying Operations Management techniques in radiologic and diagnostic imaging. We will identify protocols, policies, procedures, marketing services, customer management, andsatisfaction methods. This course will provide the student with the foundation necessary to address the day-to-day issues an imaging administrator will experience. This course will foster the student’s goal of achieving their Certified Radiology Administrator Certification (CRA). DMI430–FinancialandAssetManagementinRadiology–45ClockHours/3SemesterCreditHours Prerequisite: None This course will represent a cross-section of today’s imaging profession and give students insight and knowledge of the financial and asset management system in Radiology and its processes. This course aids imaging professionals in preparing for the Certified Radiology Administrator examination by providing educational materials specific to the field. This course will discuss in-depth insights and analyses on various financial and asset managementsubjectsanddiscussstrategicplanningandimplementingaSWOTanalysistoincreasetotal performance. DMI440–DigitalRadiography&PACS–45ClockHours/3SemesterCreditHours Prerequisite: None This comprehensive course investigates many facets of imaging informatics: information technology, imaging modality capabilities, supervision of modality integration, establishing programs for image display quality control, and recognition of specific hazards to the healthcare environment. In addition, students will learn to identify and implement medical imaging standards: DICOM, HL – 7, MQSA, ACR, ICD – 9, and SMOMED. This course prepares students for the Imaging Informatics Professional Certification exam, offered by the American BoardofImagingInformatics(ABII). DMI450–Communication&EducationinImagingInformatics–45ClockHours/3SemesterCreditHours Prerequisite: None This inclusive course discusses the roles and relationships in healthcare settings, medical terminology, communicationsrelatingtosystemavailability or changes, feedback, and feedback mechanisms. Furthermore, this course will explore performance needs assessment, training programs, implementation training, and evaluations of effectiveness training. This course prepares students for the Imaging Informatics Professional Certification exam, offered by the American Board of Imaging Informatics (ABII). DMI460–SystemsManagementinImagingInformatics–45ClockHours/3SemesterCreditHours Prerequisite: None This course explores procurement, project management, and operations of digital imaging systems. Additionally, systems management will be introduced, including cost analysis, system capacity, throughput, disaster plan recovery, business continuity strategies, use problem management, data migration procedures, data security, and individual privacy. This course prepares students for the Imaging Informatics Professional Certification exam, offered by the American Board of Imaging Informatics (ABII). DMI470–TeachingStrategiesforAdultLearnersinHealthScience–45ClockHours/3SemesterCreditHours Prerequisite: None This course imparts important information on motivating, mentoring, and instructing using scientifically based teaching strategies and tactics. There is information on providing individualized instruction in classrooms with 294

multiple learning and behavior problems and how curricula and instruction can be designed to teach functional repertoires and critical thinking rather than inert ideas. The course also discusses determining the effectiveness of curricular initiatives toward meeting standards and course objectives. DMI480–CurriculumDesigninDiagnosticImagingSciences–45ClockHours/3SemesterCreditHours Prerequisite: None This course covers the unique type of curriculum we call “competency-based.” Though not unique to diagnostic medicalimaging,wewillemphasizecurriculumdesignrelatedtotheimagingsciences.Thisclasswilltakeyou throughunderstanding,designing, implementing, and accrediting a competency-based curriculum in a diagnostic medical imaging program. EmphasiswillbepaidtothecurriculumpublishedbytheAmericanRegistryofRadiologicTechnologists®,the underpinningofmostaccreditationorganizations. Wewill also introduce you to the requirements of accrediting organizations. DMI490–MethodsofTeachingOnlineCourse–45ClockHours/3SemesterCreditHours Prerequisite: None This course introduces teaching methods applicable to any coursework in the Allied Health Sciences. DMI510–PrinciplesofComputedTomography–45ClockHours/3SemesterCreditHours Prerequisite: None This course introduces the student to digital imaging processing and image quality. Students will discuss and identify the concepts of data acquisition. In addition, knowledge of the basic principles of sectional anatomy andCTprotocolsandproceduresrelatedtovariousbodypartswillbeanalyzed.Coursetopicswillinclude digital imaging processing, data acquisition concepts, radiation dose, sectional anatomy, protocols and techniques, and pediatric CT imaging. DMI520–AdvancedApplicationsofComputedTomography–45ClockHours/3SemesterCreditHours Prerequisite: None This course introduces the student to basic physics and instrumentation principles related to computed tomography.Coursetopicsincludehistorical perspectives of the modality, physics, and physical characteristics of the computedtomographyprocess,dataacquisition,scannerdesign,imageprocessing,andimagequality. DMI530–ComputedTomographyRegistryReview–45ClockHours/3SemesterCreditHours Prerequisite: None This course reviews the computed tomography curriculum and prepares students for the ARRT® CT post-primary certification examination covering the ARRT® Exam content specifications, Patient Care, Safety, Image Production, and Procedures. This course also includes CT Basics ASRT modules and satisfies the ARRT® 16-credit Structured Education Requirements for CT. DMI540–PhysicalPrinciplesofMRI–45ClockHours/3SemesterCreditHours Prerequisite: None This course provides the student with a comprehensive overview of MR imaging principles. The subjects are formattedinindividual outlines and sequenced according to the level of knowledge desired. Topics include nuclear MRsignal production, tissue characteristics, pulse sequencing, imaging parameters/options, and image formation. DMI550–AdvancedApplicationsinMRI–45ClockHours/3SemesterCreditHours Prerequisite: None This course provides the student with imaging techniques related to the CNS, neck, thorax, musculoskeletal system, and abdominopelvic regions. Students will learn specific clinical applications, available coils and their 295

use, considerations in the scan sequences, specific protocol choices (i.e., slice thickness, phase direction, flow compensation), and positioning criteria. Anatomicalstructures, the plane that best demonstrates anatomy, and signal characteristics of normal and abnormalstructureswill be discussed. Pharmacology, as it pertains to MRI, will be discussed. Students will demonstratetheirpractices by applying their didactic knowledge in their laboratories. DMI560–MRISafetyandRegistryReview–45ClockHours/3SemesterCreditHours Prerequisite: None This course will prepare students for the required registry board exams to work as MRI Technologists. This course includes reviewing the MRI program, and the students will take mock registry board exams and practice tests. Students will learn effective ways to study and answer questions from the registry. This course provides basic knowledge of MR safety, patient preparation, and monitoring of patients in the MR suite. This information enables the student to communicate better with the healthcare team to ensure patient safety. Health effects and safety issues are important aspects of this diagnostic modality. DMI570–PrinciplesofMammography–45ClockHours/3SemesterCreditHours Prerequisite: None This course is designed to educate radiographers in the art and science of mammography. Enrollees in the course must have a California Certified Radiologic Technologist (CRT) license OR be a student in a JRCERT-accredited program. The course consists of 40 hours of lecture, which will assist in preparing for the California MammographyCertificate exam and the ARRT® Post-Primary Certification in Mammography. DMI580–AdvancedApplicationsinMammography–45ClockHours/3SemesterCreditHours Prerequisite: None This course offers students an understanding of breast ultrasound history, breast cancer, diagnosis and imaging, principles, equipment, breast anatomy and normal appearances, exam techniques, image interpretation, recording and reporting, benign and malignant disease, imaging of the augmented breast, breast disease in males, and interventional techniques. This course overviews breast ultrasound. DMI590–MammographyRegistryReview–45ClockHours/3SemesterCreditHours Prerequisite: None This course prepares students for the registry exam for mammography. Course topics will include history, patient education, anatomy, physiology and pathology of the breast, benign and malignant diseases, equipment,processingandqualitymanagement,commonimagingprocedures,emergingtechnologies, interventional procedures and treatment options review, and MQSA standards. BachelorofScienceinNursing(BSN)Courses–BlendedProgram RN100–FundamentalsofNursingTheory–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 101. Failure in one paired course equals failure in both paired courses. This course introduces professional nursing. Content includes a brief history of nursing, including the roles and responsibilities of the health care team. The provision of a standard of care consistent with legal, ethical, and regulatory guidelines and ANA Standards of Practice are emphasized. Verbal communication skills, informatics, evidence-based practice, safety, and developing a patient-centered therapeutic nurse-client relationship are fostered. Students are taught the nursing process and nursing diagnosis to develop a nursing care plan. RN101–FundamentalsofNursingClinicalandLab–157.5ClockHours/3.5SemesterCreditHours 296

Prerequisite: None Corequisite: This course is paired with RN 100. Failure in one paired course equals failure in both paired courses. This course integrates concepts, theories, and skills fundamental to nursing practice. Students will use the nursing process to plan and provide for adult patients’ cultural, physiological, social, psychological, and spiritual needswithhealthdisruptions. RN102–HealthAssessmentTheory–30ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 103. Failure in one paired course equals failure in both paired courses. This course focuses on strategies to obtain health histories and physical assessment data for diverse populations across the lifespan. Students are instructed to identify normal and abnormal findings using inspection, palpation, percussion, and auscultation. Health risk prevention and the promotion of optimal health behaviors are also addressed. RN103–HealthAssessmentSkillsLab–67.5ClockHours/1.5SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 102. Failure in one paired course equals failure in both paired courses. This course uses health assessment theory to develop the hands-on skills of inspection, palpation, percussion, andauscultation. Laboratory experience includes demonstration, practice, and critique of skill performance. RN104–Pharmacology–45ClockHours/3SemesterCreditHours Prerequisite: None In this course, the student is familiarized with a history of pharmacology, the classification of medications, their actions, application, and nursing considerations. Principles and procedures for the safe administration of medications are stressed. Basic math and computation of adult and pediatric dosages are included. Actions, interactions, applications, and nursing considerations are addressed. RN106–Pathophysiology–45ClockHours/3SemesterCreditHours Prerequisite: None In this course, pathophysiological changes in acutely ill and chronically ill patients across the lifespan using a systemandinter-systemsapproach.Thecoursecoversidentifyingpathologicalchangesinassessingpatients with major health disruptions, techniques appropriate to patients using a major systems approach, analysis of data, and description of intersystem relationships across the life span as a basis for problem-solving the nursing process. Basic EKG and arrhythmia determination and ABG analysis are included. RN180–NursingTransitionAdvancedPlacementTheory&LabCourse–120ClockHours/5SemesterCredit Hours Prerequisite: None This course introduces students to the roles and responsibilities of the registered nurse and the Associate DegreeNursingProgramframework.Emphasisisplacedonvariousrolesoftheregisterednurse,legaland ethical responsibilities, nursing process, critical thinking, and evidence-based practice, delivering competent care to diverse demographics of multicultural clients throughout the lifespan. Lecture contents include the role of the registered nurse and the care of adult, maternity, and pediatric clients. Thelabcomponentofthiscoursefocusesonutilizingthenursingprocess,criticalthinking,andapplyingtheory to skills in various patient case scenarios. The following skills competencies focused on in this course: dosage calculation, assessment, intravenous administrations, central venous access, medication administration, nasogastric feeding, foley catheter insertion, tracheostomy care, and suctioning. RN200–Medical/SurgicalITheory–IntroductiontoMed/Surg–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 201. Failure in one paired course equals failure in both paired courses. 297

This course provides basic medical/surgical theory related to endocrine, musculoskeletal, integumentary, and sensory system disorders, perioperative care, and fluid and electrolyte imbalances. Develop an understanding of the dynamic sequence of biological, psychological, and sociological changes in older adulthood. Usual growth and development patterns and disruption in critical periods of development are presented and help the developmentofnursinginsightthatwillenablesafe,effective, patient-centered care. RN201–Medical/SurgicalIClinical–IntroductiontoMed/Surg–90ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 200. Failure in one paired course equals failure in both paired courses. This course applies the theoretical content of patient-centered care of patients with medical-surgical conditions. Emphasis is on care planning, assessment, teaching, and clinical interventions to promote healthy outcomesforpatients. RN202–Medical/SurgicalIITheory–IntermediateMed/Surg–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 203. Failure in one paired course equals failure in both paired courses. This course provides basic medical/surgical theory related to endocrine, gastrointestinal, genitourinary, and hematology problems in cancer patients and palliative care. Develop an understanding of the dynamic sequence of biological, psychological, and sociological changes in older adulthood. Usual growth and development patterns and disruption in critical periods of development are presented and help the developmentofnursinginsightthatwillenablesafe,effective, patient-centered care. RN203–Medical/SurgicalIIClinical–IntermediateMed/Surg–90ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 202. Failure in one paired course equals failure in both paired courses. This course applies the theoretical content of patient-centered care of patients with medical-surgical conditions. Emphasis is on care planning, assessment, teaching, and clinical interventions to promote healthy outcomesforpatients. RN300–MaternalNewbornTheory–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 301. Failure in one paired course equals failure in both paired courses. The course covers comprehensive maternal and newborn care, beginning with preconception planning and including risks in pregnancy and postpartum, maternal and newborn complications, male and female reproductive problems and needs, and family needs and problems during the maternity cycle. Concepts of nutrition, cultural variations, and the safety of mothers and newborns are integrated. Therapeutic use of drugs during pregnancy, labor and delivery, and the immediate postpartum period are included. RN301–MaternalNewbornClinical–67.5ClockHours/1.5SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 300. Failure in one paired course equals failure in both paired courses. This course is taught at a clinical site, applying the theoretical content of patient-centered care of mothers and newborns. The emphasis is on assessment, teaching, and clinical interventions to promote healthy outcomes for families. RN302–CareofChildrenTheory–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 303. Failure in one paired course equals failure in both paired courses. This course applies the theoretical content of patient-centered care of mothers and newborns. The emphasis is onassessment,teaching,andclinicalinterventions to promote healthy outcomes for families. RN303–CareofChildrenClinical–67.5ClockHours/1.5SemesterCreditHours 298

Prerequisite: None Corequisite: This course is paired with RN 302. Failure in one paired course equals failure in both paired courses. This course is taught at a clinical site, applying the theoretical content into practice with attention to patient-centered, quality care. Interaction with family members facilitates the student’s ability to recognize family dynamics and their effects on the developmental process. Advanced skills necessary to care for pediatric patients are achieved through simulation. The application of the nursing process to optimize patient and family outcomesisemphasized. RN304–Medical/SurgicalIIITheory–AdvancedMed/Surg–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 305. Failure in one paired course equals failure in both paired courses. This course provides basic medical/surgical theory related to respiratory, cardiac, neurologic, and musculoskeletal disorders. Develop an understanding of the dynamic sequence of biological, psychological, and sociological changes in older adulthood. Usual growth and development patterns and disruption in critical periods of development are presented and help the development of nursing insight that will enable safe, effective, patient-centered care. RN305–Medical/SurgicalIIIClinical–AdvancedMed/Surg–90ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 304. Failure in one paired course equals failure in both paired courses. This course is taught at a clinical site, integrating the practical application of advanced medical/surgical theory to care for selected patients with multiple health disruptions. Students apply the nursing process to optimize patient outcomes. RN400–MentalHealthTheory–30ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 401. Failure in one paired course equals failure in both paired courses. This course addresses theories and principles of psychiatric nursing. Biopsychosocial foundations of behavior, communication, and psychopharmacology are emphasized. Patient relationships and the use of effective and ineffective communication are addressed. The nurse’s role in the prevention and early identification of psychiatric disorders of children, adolescents, adults, and older adults and the treatment modalities of mental illness and organic brain syndromes are studied. RN401–MentalHealthClinical–90ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 400. Failure in one paired course equals failure in both paired courses. This course is taught at clinical sites, applying theory into clinical practice in the care of selected patients who may experience psychological stress, neurobiological disorders, and high-risk situations such as homelessness, family violence, child abuse, HIV, and post-traumatic stress syndrome. Students apply the nursing process to optimize patient outcomes. RN402–Medical/Surgical IV Theory – Complex Med/Surg & Leadership –45ClockHours/3SemesterCredit Hours Prerequisite: None Corequisite: This course is paired with RN 403. Failure in one paired course equals failure in both paired courses. This course incorporates previous medical-surgical nursing theory emphasizing the integration of pathophysiology, nutrition, pharmacology, and psychosocial components of safe and individualized care for patients with complex medical-surgical health disruptions. Focus on holistic care for burns, heart failure, acute respiratory distress, shock, multiple organ dysfunction, and traumatic brain injury. Leadership and management in nursing are explored as they relate to managing complex medical-surgical health alterations. RN403–Medical/Surgical IV Clinical – Complex Med/Surg & Leadership–90ClockHours/2SemesterCredit 299

Hours Prerequisite: None Corequisite: This course is paired with RN 402. Failure in one paired course equals failure in both paired courses. This course is taught at a clinical site, integrating the practical application of advanced medical/surgical theory to care for selected patients with multiple health disruptions. Students apply the nursing process to optimize patient outcomes. RN404–CommunityHealthNursingTheory–45ClockHours/3SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 405. Failure in one paired course equals failure in both paired courses. This online course discusses the foundation for community public health nursing care of patients, families, and communities. Sociocultural, political, and economic influences on a community’s health and the health care systemareexplored,aswellascurrentissuesandtrendsaffectingcommunitypublichealth. RN405–CommunityHealthNursingClinical–90ClockHours/2SemesterCreditHours Prerequisite: None Corequisite: This course is paired with RN 404. Failure in one paired course equals failure in both paired courses. Applying nursing and epidemiological concepts to promoting health and preventing disease among patients, families, and communities will be performed through assigned project completion, aligned with the concurrent Community Health Nursing Theory class topics. Students will explore intervention strategies that empower clients with the knowledge and skills to make informed and healthful choices. RN500–Leadership/ManagementinNursingTheory–45ClockHours/3SemesterCreditHours Prerequisite: None Thenursingprofessioninvolvesleadership, management,teambuilding,andcollaborationstrategies. Social, legal, political, and economic factors are explored in nursing and health care. Concepts and principles of professional nursing practice, such as quality improvement, safety, and evidence-based practice, are integrated. Developmentofchange,agent,anddelegationskillswillbeconsidered. RN501–Leadership/ManagementinNursingClinical–90ClockHours/2SemesterCreditHours Prerequisite: None This practical implementation of leadership and management theory concepts uses assigned clinical projects throughinterviews and analysis of existing clinical practices. This is a 2-unit practical course. RN502–NursingInformatics–45ClockHours/3SemesterCreditHours Prerequisite: None This course covers the principles, concepts, and applications of the health informatics discipline. Core disciplines, including informatics and terminal competencies or learning outcomes, provide the framework for developing curricula within the healthcare professions. Learning outcomes include the skills, knowledge, and professional aptitudes expected of all graduates. RN504–NursingResearch–45ClockHours/3SemesterCreditHours Prerequisite: None This course builds on the Research Statistics course taught in Semester 1. Principles, concepts, and application of scientific inquiry to phenomena of concern to other health professions and nursing and client’s health experience are covered. Research design, critique, and interpretation of reports from various health sources will occur, and participation in research and conducting research will be discussed. RN505–BachelorsAchievementCapstonePortfolio–45ClockHours/3SemesterCreditHours Prerequisite: None This is a study project where BSN students prepare a professional portfolio and work from Semester 7 end to Semester8end.Itistobecomposedofamultitudeofindividualprojectsanddocumentspreparingthestudent 300

for professional practice as an SN with a BSN. This portfolio is the exit project for the bachelor’s degree in Nursing program. BachelorofScienceinRadiationTherapy(B.S.inRT)Courses–FullDistanceEducationProgram RTT250–IntroductiontoRadiationTherapy–30ClockHours/2SemesterCreditHours Prerequisite: Completion of GE 020A, GE 020B, GE 222, and GE 240. This course will provide students with an overview of the Radiation Therapy major. Instruction will include a review of professional organizations, department structure, patient management, record keeping, and professional ethics. An overview of the radiation therapist’s role in cancer treatment, including a review of the therapist’s scope of practice, developing modalities, and advanced career opportunities, takes place. RTT300–Sectional/TopographicAnatomy–45ClockHours/3SemesterCreditHours Prerequisite: Completion of semesters I, II, and III. This course will examine external anatomic landmarks concerning internal anatomy, emphasizing the effects of positioning on external landmarks, internal anatomical critical structures, and methods of avoiding or lowering radiation doses to these structures. The sectional imaging course will introduce students to different modalities utilized in radiation therapy. Identification of anatomical structures will be reviewed, identifying the various medical imaging methods. Basic anatomical relationships will be compared using topographical and cross-sectional images. RTT315–MedicalImaging–45ClockHours/3SemesterCreditHours Prerequisite: Completion of semesters I, II, and III. This course establishes a knowledge base on factors that govern and influence the production and recording of medical images for patient simulation, treatment planning, and treatment verification in Radiation Oncology. Concepts and processes involved in producing a radiograph will be covered. Other diagnostic imaging modalities such as CT, MRI, and ultrasound will be covered. General radiography, computerized tomography, magnetic resonance imaging, nuclear medicine, sonography imaging modalities, and equipment will be emphasized. Imaging and processing content for radiation oncology describes the factors that affect the production and recording of radiographic images for patient simulation, treatment planning, and treatment verification, emphasizing radiation oncology imaging equipment and related devices. A review of radiation protection conceptswill be provided. RTT320–ClinicalConceptsI–45ClockHours/3SemesterCreditHours Prerequisite: Completion of semesters I, II, and III. This course provides students with an overview of cancer and the specialty of radiation therapy. Historical and current aspects of cancer treatment and the basic principles and practices of treatment and simulation will be emphasized. Content provides students with a knowledge base for assessing, comparing, contrasting, and recommending the type of radiation therapy equipment, procedure and technique, patient positioning, and immobilization for appropriate tumor localization and treatment delivery. RTT330–Ethics–25ClockHours/1.5SemesterCreditHours Prerequisite: Completion of semesters I, II, and III. This course examines professionalism and bioethics, the process of making moral decisions, ethical issues, professional oaths and codes of ethics, health care ethics, and the law. RTT340–RadiationTherapyPatientCare–45ClockHours/3SemesterCreditHours Prerequisite: Completion of semesters I, II, and III. This course will focus on the foundational concepts and competencies in evaluating patients before, during, and 301

after the delivery of radiation therapy. The psychosocial needs of patients, factors affecting treatment outcomes, assessment, and evaluation will be discussed. The course also explores local, state, and national cancer care resources. This course examines the psychological and physical needs and factors affecting treatment outcomes.Routineandemergencycareprocedures,pertinentlaboratoryresults,andtheireffectson radiation therapy will be discussed. RTT355–ClinicalOncology–45ClockHours/3SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, and V. This course focuses on examining oncologic pathology with an emphasis on malignant neoplasia. The course focuses on cancer and current treatment modalities, emphasizing radiation therapy, and is designed to examine and evaluate the management of neoplastic diseases. Cancers of the skin, brain, head and neck, thorax and gastrointestinal, genitourinary, lymphoreticular, musculoskeletal, integumentary, hematopoietic, and endocrine systems are emphasized. The epidemiology, etiology, natural history, diagnosis, treatment strategies, sequelae, andprognosisarediscussed. RTT365–ClinicalConceptsII–45ClockHours/3SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, and V. This course focuses on assessment, evaluation, and treatment plans for treatment-related side effects. The radiation therapist’s responsibility in managing the neoplastic disease will be examined and linked to specific professional skills within their scope. The roles and responsibilities of the radiation therapist, the treatment prescription, the documentation of treatment parameters and delivery, emergency procedures, patient condition, and education needs will be presented, discussed, examined, and evaluated. Content provides a knowledge base for assessing, comparing, contrasting, and recommending the type of radiation therapy equipment, procedure and technique, patient positioning, and immobilization for appropriate tumor localization and treatment delivery. A thorough examination of site-specific techniques used in radiation therapy is covered. RTT400–ClinicalRadiationTherapyPhysicsI–60ClockHours/4SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, and V. This course will introduce students to the nature and description of the structure of matter and energy, interactions of photons and gamma radiation, instrumentation and measurement of ionizing radiation, beam quality and dose, percent depth dose, tissue air ratios, and treatment dose calculations. RTT410–ClinicalRadiationTherapyPhysicsII–60ClockHours/4SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, V, VI, and VII. This course will emphasize the practical applications of electron and photon beams and the use of radioactive sources. Methods of calculating dose at any point in clinical set-ups are covered. Modern technology such as 3DCRT and IMRT are introduced. Imaging modalities in radiation oncology, such as film and electronic digital portal (EDIP) imaging, are presented. The concepts of radiation protection, shielding, and fundamentals of quality assurance programs from physics and clinical perspectives are presented. RTT420–QualityManagement–45ClockHours/3SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, V, VI, and VII. This course offers a systematic look at quality assurance in radiation therapy. The evaluative measures, procedures, national guidelines, and principles are examined. Quality assurance and quality improvement, as well as its tools and components, will be covered. Content is designed to focus on the components of quality improvement programs in radiation oncology. The course includes quality control and assurance checks for clinical aspects of patient care, medical records, treatment delivery and localization, and treatment planning equipment.Legalandregulatoryimplicationsformaintainingappropriatequalitycarewillbecovered. RTT430–ResearchinRadiationTherapy–45ClockHours/3SemesterCreditHours 302

Prerequisite: Completion of semesters I, II, III, IV, and V. This course will address reading and researching radiation therapy. Research approaches and procedures will be explored. Examples of various research methods and techniques will be discussed. Students will be assigned a research project during their time in the program. Research projects will be submitted in the Capstone course. RTT440–Dosimetry–45ClockHours/3SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, V, VI, and VII. This course will provide content designed to examine factors that influence and govern the clinical planning of patient treatments. This encompasses isodose distributions, influence modification, radiobiological considerations, dosimetric calculations, and clinical application of radiation. Topics will include the effects of treatment distance, beam weighting, beam modifiers, irregular fields, tissue inhomogeneities, and compensating filters. Electromagnetic and particulate beams, as well as advanced and emerging technologies, are covered. Evaluation of treatment plans emphasized. RTT450–OperationalIssues–30ClockHours/2SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, V, VI, and VII. This class will focus on various radiation therapy operational and budgetary issues, hospital and governmental accreditation, types of insurance, coding, and reimbursements. Professional roles, responsibilities, and development will be emphasized. Synthesis of previous didactic and clinical information; an in-depth examination of current and future professional issues, technological advances, and ethics; a look at professional preparation, organizations, and continuing education are discussed. RTT460–Radiobiology–45ClockHours/3SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, V, VI, and VII. This course discusses the principles and concepts, including radiation effects on cells, organs, systems, and levels within the entire body. Emphasis is on the theories and principles of tolerance dose, time-dose relationships, fractionation schemes, and the relationship to the clinical practice of radiation therapy. RTT470–RadiationTherapyClinicalExternshipI–570ClockHours/12.5SemesterCreditHours Prerequisite: Completion of semesters I, II, III, and IV. Content is designed to provide sequential development, application, analysis, integration, synthesis, and evaluation of concepts and theories in radiation therapy. This course’s objectives and competencies focus on patient-centered care, teamwork principles, introduction to and safety procedures for treatment and simulation equipment, and introductory level treatment procedures. Students will complete a simulation and treatment rotation during this course. RTT471–SeminarinRadiationTherapyI–15ClockHours/1SemesterCreditHour Prerequisite: Completion of semesters I, II, III, and IV. This course is designed to support learning in Radiation Therapy Clinical Internship I. Students will meet to discuss clinical progress and procedural information specific to radiation therapy and perform structured assignments utilizing the clinical setting for learning. Content for this course includes patient population and statistics, patient flow in the department, various components of a department, interdepartmental interactions and interactions with other departments, and the exploration and discussion of the various treatment modalities available. RTT475–RadiationTherapyClinicalExternshipII–570ClockHours/12.5SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, V, and VI. Continuation of clinical externship practice. This course focuses on specific principles and techniques utilized for assigned cancer treatments. Students will demonstrate clinical competencies in the application of specific radiation therapy techniques. Students will conduct assisted and technical treatment and simulation procedures. Students will complete nursing, simulation, and treatment rotations during this course. 303

RTT476–SeminarinRadiationTherapyII–15ClockHours/1SemesterCreditHour Prerequisite: Completion of semesters I, II, III, IV, V, and VI. This course is designed to support learning in Radiation Therapy Clinical Internship II. Students will meet to discuss clinical progress and procedural information specific to radiation therapy and perform structured assignments utilizing the clinical setting for learning. Content for this course includes patient population and statistics, patient flow in the department, various components of a department, interdepartmental interactions and interactions with other departments, and the exploration and discussion of the various treatment modalities available. RTT485–RadiationTherapyClinicalExternshipIII–480ClockHours/10.5SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, V, VI, VII, and VIII. Continuation of clinical externship practice. This course focuses on specific principles and techniques utilized for assigned cancer treatments. Students will demonstrate clinical competencies in the application of specific radiation therapy techniques. Students will conduct technical and competent to perform treatment and simulation procedures. Students will complete a simulation and treatment rotation during this course. RTT486–SeminarinRadiationTherapyIII–15ClockHours/1SemesterCreditHour Prerequisite: Completion of semesters I, II, III, IV, V, VI, VII, and VIII. This course is designed to support learning in Radiation Therapy Clinical Internship IV. Students will meet to discuss clinical progress and procedural information specific to radiation therapy and perform structured assignments utilizing the clinical setting for learning. Content for this course includes patient population and statistics, patient flow in the department, various components of a department, interdepartmental interactions and interactions with other departments, and the exploration and discussion of the various treatment modalities available. RTT490–RadiationTherapyCapstone–60ClockHours/4SemesterCreditHours Prerequisite: Completion of semesters I, II, III, IV, V, VI, VII, and VIII. This course examines historical and current issues in the profession. This class will review the professional components of radiation therapy and the expectations of being part of a functional department. This course will address preparation for employment, from resume writing to interview techniques and the professional scope of practice. Preparation for entry into the profession and completion of the capstone project will be accomplished. BoneDensitometryTechnician(DXA)Courses–BlendedProgram DXA101–FundamentalsofBoneDensitometry–40ClockHours/3.5QuarterCreditHours Prerequisite — None This course covers the basic understanding of bone densitometry (DXA) through fundamentals of the equipment, patient care and patient prep. The course will cover radiation physics and protection and best practice in scanning patients including DXA scanning analysis. We will also look at additional applications that assist in the diagnosis of fracture risk, and detect low bone density and current Interventions. DXA101C–ClinicalPracticeI–16ClockHours/0.5QuarterCreditHours Prerequisite: Completion of DXA 101 with a “C” or better. Clinical experiences are designed to provide patient care and assessment, competent performance of Bone Density imaging, and total quality management. The concepts of team practice, patient-centered clinical practice, and professional development are evaluated through structured, competency-based clinical education. Levels of competency ensure the well-being of the patient prior to, during, and following the radiologic procedure. DentalAssistant (DA) Courses – Blended Program 304

DA100–InfectionControl–10.5ClockHours/0.5QuarterCreditHours Prerequisite: None This course is a prerequisite to begin the dental assisting program. The course contains four (4) hours of didactic andfour(4)hoursofpracticalapplications that will explain the basic dental science and microbiology related to infection control in dentistry. Thecourseexplainsthelegalandethicalaspectsofinfectioncontrolproceduresandthetermsandprotocols specified in the board’s regulations regarding the minimum standards for infection control. Describe the principles of modes of disease transmission and prevention. This course explores hand hygiene principles, techniques, protocols, personal protective equipment, surface barriers and disinfection, sterilization, sanitation, and hazardous chemicals associated with infection control. Explain the principles and protocols of sterilizer monitoring and the proper loading, unloading, storage, and transportation of instruments to the work area. Describe and demonstrate the principles and protocols for sharps management,waterlinemaintenance,andinfectioncontrolforlaboratoryareas. DA200–FundamentalsofDentalAssisting–126ClockHours/6QuarterCreditHours Prerequisite: None This course covers an overview of the dental profession, healthcare teams, the history of dentistry through the ages, and the legal and ethical responsibilities expected of a dental professional. Students will learn about the landmarksofthefaceandoralcavity,toothnumbering,patternsoferuption,andthefunctionsofthedental arch and teeth in the opposing arch. Students will classify dental caries as an infectious disease and name the types of bacteria that cause caries. Thestudentwillbeabletoidentifysystemicfactorsthatmaycauseperiodontaldisease,describethetwobasic types of periodontal disease, and explain the significance of plaque and calculus in periodontal disease. DA201–SciencesofDentistry/InfectionPrevention–126ClockHours/6QuarterCreditHours Prerequisite: None This course instructs on the location, structures, and functions of head and neck anatomy, including the bones of the head and face, musculature, innervations, and the circulatory system. Coursework includes an introduction to the terminology and functions of body systems. Students will be able to describe specific terms relative to the general anatomy and physiology of the human body, including systems, planes, cavities, basic units, and microorganisms affecting humans. The students will beabletodescribetheimportanceofpreventingoraldisease,treatingperiodontaldisease,andinfection control standards. These include requirements of the OSHA Bloodborne Pathogens Standard, hazardous materials handling, labeling, inventory, housekeeping, laundry, and disposal of hazardous materials will be covered. This course also provides instruction on inflammation, identification of oral lesions, oral diseases, related biological, physical, and chemical agents, and hormonal, developmental, and nutritional disturbances. Students will be instructed in basic pharmacology and drugs associated with treating diseases, their use in dentistry, related terms, parts of a prescription, and types of anesthetics. DA202–FoundationsofClinicalDentistry–126ClockHours/6QuarterCreditHours Prerequisite: None This course addresses the parts of dental hand instruments, categories and uses, functions of dental burs, abrasives, and dental handpieces, and the importance and function of instrument tray systems and color coding. This course teaches the types of restorative materials and cements used in general dentistry. The 305

student will describe the dental assistant’s role in chairside restorative procedures and the properties of dental materials. DA203–DentalMaterials/CoronalPolishing–126ClockHours/6QuarterCreditHours Prerequisite: None This course provides instruction regarding various expanded dental functions. Students prepare, apply, and removeadentaldam,dentalmatrix,andwedge.Studentsprepare,manipulate,andplacedentalcavityliners, varnish, and types of cement. Thestudentcanperformsutureremovalandpostoperativepatientcarefollowingoralsurgicalprocedures.The student will describe the placement and removal of gingival retraction devices, preparation, and application of enamelsealantmaterial,benefitsanddentalbleachingmaterialstypes,applicationtechniques,andpatient education instructions. DA204–RadiologySafety/Administrative–126ClockHours/6QuarterCreditHours Prerequisite: None This course teaches radiation’s history and biological effects, safety precautions, dental X-ray unit components, andfunction. X-ray study explains how X-rays are produced, and students describe dental X-ray film’s composition, sizes, types, and storage requirements. Students will be instructed to expose and process diagnostically acceptable intraoral and extraoral dental films using paralleling and bisecting techniques. Commonproductionerrors,processingtechniques,mountingprocedures,identificationofradiographic landmarks, the procedures and state policies required for dental offices to ensure quality radiographs, and imagingsystemsfordentalpurposesarecovered.Studentswillstudytheoverallaspectsofdentaloffice management,includingpatientreception,marketing,telephonetechnique,businessofficesystems,patient scheduling, records management, accounts receivable, management of patients’ accounts, accounts payable, inventory control, and recall systems management. Thestudentwilldescribetheimportanceofaccuratechartingandinterpretationfordiagnosis,consultation, andfinancial and billing purposes. Computerized business office systems for the dental office are explored for patient scheduling, records management, patient accounts, and accounts payable. Students develop self-awareness and the importance of communication skills. Emphasiswillbeplacedonassessingprofessionalqualifications, including developing a job search network, interview strategies, and interview follow-up. Students will create resumes and cover letters and review the application completion process. DA205–DentalSpecialties/PatientAssessment–126ClockHours/6QuarterCreditHours Prerequisite: None This course addresses dental office design, working environment, the performance of four-handed dental procedures, instrument grasp and transfer, and requirements for special needs patients. The scope of oral and maxillofacial surgery, orthodontics, pediatric dentistry, and periodontics will be covered. Students will also receive instruction on identifying the equipment used for procedures within oral and maxillofacial surgery, orthodontics, pediatric dentistry, and periodontal practice. Instruction includes preparation for common medical and dental emergencies. That includes cardiopulmonary resuscitation, syncope treatment, anaphylaxis, asthma attacks, heart conditions, cerebrovascular accidents, and commondentalemergencies.StudentsarerequiredtopassCPRcertificationduringthiscourse. Students will be able to provide patient instruction in removable and fixed prosthodontics. This includes diagnostic steps, materials required for treatment, the importance of a consultation appointment, the advantagesanddisadvantagesofpartialandfulldentures,thestepsrequiredindenturepolishing,relining, 306

repair, and the function of an overdenture. The definition of an endodontist and how endodontics relates to dental practice are also included. DA300–ClinicalExternship–180ClockHours/6QuarterCreditHours Prerequisite: None Theclinical externship is an eight (8) week course that includes student placement in a facility that performs various skills. The student must complete an average of 20 – 30 hours a week. The externship provides exposuretohands-onpractice.Theexternshipallowsstudentstoapplytheoryconceptstoassistthedental staff with daily duties in the front and back offices under staff supervision. This experience marks the transition frombeingastudenttobecomingaDentalAssistant. MasterofScienceinNursing(BSNtoMSN)Courses–FullDistanceEducationProgram MSN506–TheoreticalFoundationsofAdvancedNursingPractice–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. This course provides the learners with the theoretical foundations of nursing. Learners examine the relationship between nursing theories and the development of nursing science. The course focuses on the relationships betweentheories,research,andnursingpracticewithcurrentscientific advances. MSN508–FutureofNursingandHealthcarePolicy–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. This course allows students to research, develop, and discuss policies affecting advanced nursing and healthcare systems. Advocating for effective policies impacting nursing and its stakeholders is another vital componentofthiscourse. MSN 510 – Advanced Research Methodologies and Analysis- Evidence-Based Practice – 45 Clock Hours/3 SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. The learners receive knowledge regarding integral components of evidence-based practice with research to foster scholarship and holistic and person-centered care in diverse healthcare environments. Content interconnected to problem identification, research methodologies, critique of findings and literature, and application to evidence-based practice is presented. Developing an evidence-based project focusing on quality improvementorsafetyallowsstudentstopracticelearnedprinciples. MSN512–FinancialResourceManagement–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. This course introduces students to financial management concepts in healthcare. Emphasis is placed on resource allocation in healthcare organizations. Students will study the theory and practice of financial management relevant to healthcare delivery organizations. The following elements will be discussed to enhance understanding of key concepts, including accounting practices, financial and policy issues, financial control techniques, financial decision-making, and reading and analyzing financial statements. MSN514–LeadershipandManagementinNursingandHealthcare–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. This course presents the management functions and leadership roles of professional and contemporary nursing within an organizational structure. The management operations (staffing, planning, organizing, coordinating, and controlling) prepare the structure for the course. The imperative focus is given to organizational, behavior, andmanagementtheories. Methods of inquiry, including the nursing process, problem-solving models, and decision-making, are emphasized as tools for analyzing intricate leadership and management complications common to nursing leaders and managers. Emphasis is also provided on collaborative relationships, quality assurance 307

accountability in nursing care, and multidisciplinary communication. Complex ethical issues in management are discussed, the legal authority for nursing practice and the impact of legislative and political processes. MSN516–AdvancedHealthcareTechnology&Informatics–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. This course presents the functions, roles, scope, and standards of practice to the learner. Students will analyze, explore, implement, and evaluate diverse aspects of nursing informatics practice as a specialization. Topics include utilizing and implementing technology for virtual care delivery and monitoring and focusing on complementary roles of the master’s-prepared informatics nurse specialist and other information-technology professionals. MSN 600 – Advanced Health Assessment, Pathophysiology, Pharmacology – 45 Clock Hours/3 Semester Credit Hours Prerequisite: Completion of BSN Degree and Active RN License. This course content builds upon undergraduate nursing education and practice experience. The course concentrates on and further develops nursing knowledge and skills related to health assessment, pharmacology, and pathophysiology across the lifespan. The vital focal point is on advanced and contemporary knowledgeandskillsindirect- and indirect-care roles that nurse educators need. MSN602–CurriculumDevelopment–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. The main focus of this course highlights the processes of curriculum development. Students will research traditional and innovative approaches to program development implemented in various educational environments. Curriculum and instruction are examined within a theoretical framework. MSN604–TeachingandLearningProcessandStrategies–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. The main focus of this course is to highlight the various methods of teaching strategies and appraisal of the approaches utilized to provide an effective learning environment. The teaching strategies evaluated are reviewed andappliedinthenurseeducatorroleandnursingeducationpractice.Thiscoursewillhelpintherole of an educator by acquiring skills that can offer a more versatile approach to teaching strategies. Learners will compare and contrast methods to enhance lessons, materialism, and evaluation instruments throughout the course. The course will instruct the students on implementing research findings, comparative teaching strategies, and the relationships between teaching strategies and learning/teaching styles. MSN605–NursingPracticumA–ClinicalNurseEducator–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. This course allows learners to apply concepts and expand skills in curriculum development, classroom and clinical teaching, and assessment methods in an educator role within the learner’s specialization. The student may select from various opportunities in clinical settings with staff nurses, patients, and nurse educators in clinical and academic settings. Students will acquire experience networking with administrators, faculty, and support service personnel in their chosen institution(s). The student will complete 45 hours (3 credits) of practicum in an educator role. This course is intended to meet the ABHES requirement for a culminating assessment. MSN606–AssessmentandEvaluationofLearning–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. This course assesses and examines the theory, logic, and practice of educational measurement. Comparisons are made between evaluation concepts and assessments, frameworks, and models. These will also be analyzed for relevancy and applicability in the curriculum development quality assurance processes. The practical application of measurement theory to constructing and utilizing educational evaluation instruments is 308

supported. MSN607–NursingPracticumB–AcademicNurseEducator–45ClockHours/3SemesterCreditHours Prerequisite: Completion of BSN Degree and Active RN License. This course allows learners to apply concepts and expand skills in curriculum development, classroom and clinical teaching, and assessment methods in an educator role within the learner’s specialization. The student may select from various opportunities in clinical settings with staff nurses, patients, and nurse educators in clinical and academic settings. Students will acquire experience networking with administrators, faculty, and support service personnel in their chosen institution(s). The student will complete 45 hours (3 credits) of practicum in an educator role. This course is intended to meet the ABHES requirement for a culminating assessment. MedicalAssistant(MA)Courses–BlendedProgram MA100–FrontOfficeRecordsManagement–82.5ClockHours/5.5QuarterCreditHours Prerequisite: None This course introduces creating and maintaining a patient medical record. Training includes earning a Health Insurance Portability and Accountability (HIPAA) training certificate. The use of computers in modern medical settings, including managing patient appointments and overseeing a medical records system, is reviewed. Students will study HIPAA, computerization, appointment, and records management terminology. Professional telephone communication skills are simulated. Students practice EKGs and prepare for the Certified EKG Technician certification examination in their final Front Office Course. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation Hours is 27.5 hours. MA101–FrontOfficeFinances–82.5ClockHours/5.5QuarterCreditHours Prerequisite: None This course introduces students to managing all medical office finances. Practice includes diagnostic and procedural coding for insurance billing. Students will track claims reimbursement, process patient statements, andreviewfeecollectionprocesses. Students will study terminology associated with financial management. In their final Front Office Course, students will practice EKGs and prepare for the Certified EKG Technician certification examination. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation Hours is 27.5 hours. MA102–FrontOfficeMedicalProfessionals–82.5ClockHours/5.5QuarterCreditHours Prerequisite: None This course teaches students the fundamentals of medical front office management, common management styles, and associated terminology. Professional communication skills that frame a patient-friendly experience are practiced in written communications with patients, vendors, and insurance companies. The oversight of reception and treatment areas, patient and employee safety, supplies inventory and ordering, employee training, and office emergency preparedness are included. In their final Front Office Course, students will practice EKGs and prepare for the Certified EKG Technician certification examination. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation Hours is 27.5 hours. 309

MA107–AnatomyandPhysiologyforMedicalAssistantsI–19ClockHours/1.5QuarterCreditHours Prerequisite: None Anatomy and Physiology for Medical Assistants I begins with an introduction to the foundation of Anatomy and Physiology, including levels of organization, organ systems, cell structure, and tissues and Membranes. The Integumentary, Skeletal, and Muscular Body Systems will be taught. The study of each Body System includes Structure, Function, Pathology, and associated diagnostic procedures. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation Hours is 7.5 hours. MA108–AnatomyandPhysiologyforMedicalAssistantsII–19ClockHours/1.5QuarterCreditHours Prerequisite: None Anatomy and Physiology for Medical Assistants II studies the nervous, endocrine, circulatory systems, and the senses. The study of each Body System includes Structure, Function, Pathology, and associated diagnostic procedures. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation Hours is 7.5 hours. MA109–AnatomyandPhysiologyforMedicalAssistantsII–18ClockHours/1.5QuarterCreditHours Prerequisite: None Anatomy and Physiology for Medical Assistants III is a study of the Respiratory, Digestive, Urinary, and Reproductive Systems. The study of each Body System includes Structure, Function, Pathology, and associated diagnostic procedures. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation Hours is 7.5 hours. MA120A–MedicalTerminologyA–15ClockHours/1QuarterCreditHours Prerequisite: None This course introduces Medical Terminology foundations, including Word Roots, Suffixes, and Prefixes. As learning progresses, students learn terms associated with each Body System. Throughout the course, Adaptive Learning exercises that drive student memorization and Quizzes and Examinations reinforce understanding. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation is five (5) hours. MA120B–MedicalTerminologyB–15ClockHours/1QuarterCreditHours Prerequisite: Completion of MA 120A with a “C” or higher. This course builds upon principles learned in Medical Terminology A, including Word Roots, Suffixes, and Prefixes. Students learn terms associated with each Body System. Medical Record Case Studies are evaluated, and terminology associated with Medical Specialties is practiced. Adaptive Learning exercises support and drive student memorization. ModuleQuizzesandExaminationsreinforceunderstanding. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation is five (5) hours. MA200–BackOfficeClinicalFoundations–80ClockHours/4.5QuarterCreditHours Prerequisite: None This course introduces students to clinical patient care. Students will practice professional medical communication with patients and colleagues. Students are taught minor surgery assistance procedures, including setting up, instrument sterilization, and autoclave technique. They learn aseptic medical practice as 310

OSHA requires for exposure control and medical waste disposal. Aseptic practice is reinforced through needle safety techniques, medication administration, and blood drawn from a vein during phlebotomy. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation Hours is 25 hours. MA201–BackOfficeClinicalSkills–80ClockHours/4.5QuarterCreditHours Prerequisite: None This course introduces students to clinical skills associated with a physical examination. Medical ethics are explored, including guarding private information and protecting patients’ rights. Pharmacologic terminology and abbreviations are practiced. Math skills to correctly calculate dosages and convert grams and ounces for medicineadministration are practiced. Students practice and review associated drugs, lab tests, diagnostic studies, and treatment courses. Students study First Aid and earn CPR Basic Life Support certification through the American Heart Association (AHA BLS for Healthcare Providers). Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation Hours is 25 hours. MA202–BackOfficeClinicalLaboratory–82.5ClockHours/4.5QuarterCreditHours Prerequisite: None This course introduces students to Microbiology and Blood Chemistry. Students practice asepsis and the disposal of biohazard waste. Students will practice laboratory procedures, including urinalysis, phlebotomy, and hematology. Students will review the purpose and categories of laboratory tests, including collecting, labeling, transporting, and handling specimens. Students are required to complete outside-of-class hours. The minimum estimated time for Outside School Preparation Hours is 27.5 hours. MA300–ClinicalExternship–180ClockHours/6QuarterCreditHours Prerequisite: Completion of MA 100 – MA 220 with a “C” or better. Aclinical Externship is a 6-week student placement in a facility that performs various skills depending on specialty. It provides hands-on practice exposure and an opportunity to apply theoretical concepts. The student will assist facility staff with daily duties in the front and back offices under staff supervision. This experience marksthetransitionfrombeingastudenttoperformingasaMedicalAssistant. Vocational Nurse (VN) Courses – Blended Program EMB001–EssentialMedicalBioscience–80ClockHours Prerequisite: This course is required for Vocational Nurse Program admission. This course considers the basics of general and human biology. Students examine topics in molecular and cell biology, human anatomy, microbiology, nutrition, and biochemistry while incorporating some basic medical terminology into the course material, reviewing basic math skills, and preparing for drug calculations. This is a prerequisite course for entering professional education programs at Gurnick Academy of Medical Arts. VN100–FundamentalofNursing–96ClockHours/9.5QuarterCreditHours Prerequisite: Completion of EMB 001 – Essential Medical Bioscience with 80% or higher. Concurrent enrollment is required with all Module I VN courses. Corequisite: This course is paired with VN 130. Failure in one paired course equals failure in both paired courses. This course begins with a historical perspective on the art and science of nursing and the legal and ethical aspects of the nursing profession. The nursing tools of critical thinking, communication skills, teaching ability, 311

and cultural sensitivity are presented and analyzed, emphasizing the nursing process, nursing diagnoses, documentation,andtherapeuticnurse/clientrelationship exploration. The core of the course emphasizes the Licensed Vocational Nurse’s role in meeting the basic physiologic needs of the client. Normal physiologic processes are presented as a means of comprehending abnormal processes. VN110–AnatomyandPhysiology–56ClockHours/5.5QuarterCreditHours Prerequisite: Completion of EMB 001 – Essential Medical Bioscience with 80% or higher. Concurrent enrollment is required with all Module I VN courses. This course covers the structure and function of the human body. The single cell through all body systems and theinterrelatedness of the body’s structures and functions are examined. Basic fluid, electrolyte, and acid/base balance concepts are included. VN120–ClinicalNutrition–32ClockHours/3QuarterCreditHours Prerequisite: Completion of EMB 001 – Essential Medical Bioscience with 80% or higher. Concurrent enrollment is required with all Module I VN courses. This course considers the basics of Human Nutrition in Health and Disease. This course focuses on Medical Nutrition Therapy, specifically nursing care in inpatient and outpatient settings. This course’s main goal is to teach and prepare VN students to complete basic screening, assess patients’ nutritional status, and participate in medical nutritional interventions and therapy. These include therapeutic diets, mechanically altered diets, enteral and parenteral nutrition support, pre- and post-operative nutrition therapy, and many others. VN130–ClinicalLabI–120ClockHours/6QuarterCreditHours Prerequisite: Completion of EMB 001 – Essential Medical Bioscience with 80% or higher. Concurrent enrollment is required with all Module I VN courses. Corequisite: This course is paired with VN 100. Failure in one paired course equals failure in both paired courses. This practical skill lab course is an introduction to clinical practicum. Nursing skills are structured and covered in the following order: basic nursing skills, which include basic principles of nursing such as the role and responsibility of the nursing team, the nursing process and nursing and psychiatric care plan, delegation, patient and resident rights, and medical asepsis. This is followed by bathing, bed making, body mechanics and exercise, measurements, normal elimination, personal hygiene and grooming, concepts of safety and restraints, and preventing and treating pressure ulcers. Intermediate nursing skills include enteral nutrition, ostomy care, oxygenation, preoperative and postoperative nursing care, specimen collection, urinary catheter management, wound care, and suctioning. Advanced nursing skills cover managing non-parenteral medications and safe medication administration. Students will be readytoapplytheirnursingskills in real-life clinical settings upon course completion. VN200–Medical/SurgicalNursingI–88ClockHours/8.5QuarterCreditHours Prerequisite: Completion of VN 100, VN 110, VN 120, and VN 130 with 75% or higher. Concurrent enrollment is required with all Module II VN courses. Corequisite: This course is paired with VN 220. Failure in one paired course equals failure in both paired courses. The first course of the medical/surgical nursing series, through a study of theory relative to the adult client, covers basic pathology, signs, symptoms, incidence, methods of diagnosis and treatment, and medical and surgical conditions. Emphasis is placed on the effect and nursing implications of commonly used drugs, and diet modifications are explored. The role of the practical nurse in caring for aging patients, both in the home and medical settings, is explored. Clinical experience and client-centered conferences are used to reinforce classroom theory. This course introduces students to the foundation of medical-surgical nursing, such as caring for clients with altered fluid, 312

electrolyte, and acid-base balance, caring for clients in pain, experiencing shock, trauma, and critical illness. The caring for clients with inflammation, infection, altered immunity, loss, grief, and end-of-life care are also covered. Disrupted respiratory, cardiovascular, hematologic, and lymphatic functions are discussed, emphasizing nursing and continuing care. Specific consideration is given to caring for clients with cancer and oncological care. VN210–PharmacologyI–40ClockHours/4QuarterCreditHours Prerequisite: Completion of Anatomy & Physiology for Healthcare Professionals at Gurnick Academy of Medical Arts or an equivalent Anatomy & Physiology course taken at community colleges or universities, approved by the academic director of Gurnick Academy of Medical Arts. This course is the first of two required courses in pharmacology that discuss drug regulations, classification, categorization, administration methods, and metabolism. The basic concepts of pharmacokinetics and pharmacotherapywillbediscussed. Students will also be introduced to and learn about medications affecting the cardiovascular system and drugs affecting fluid, acid-base, and electrolyte balance. Drugs impacting other organ systems will be briefly introduced but discussed later in the Advanced Pharmacology course. VN220–ClinicalII–278ClockHours/9QuarterCreditHours Prerequisite: Completion of VN 100, VN 110, VN 120, and VN 130 with 75% or higher. Concurrent enrollment is required with all Module II VN courses. Corequisite: This course is paired with VN 200. Failure in one paired course equals failure in both paired courses. This course consists of twelve weeks of externship, integrated with Medical-Surgical Nursing I. Externship schedules will vary as to the term for each student, which allows students to relate theory to practice in a supervised situation. The student’s ability to provide safe and effective nursing care to selected clients is evidencedbymeetingspecificbehavioralobjectivesineachclinicalarea. The student’s progress is documented on the student’s Clinical Progress Sheet. Lack of satisfactory performance is documented on the Counseling/Probation form. A detailed quarterly clinical evaluation is performed on each student with full faculty participation. Clinical areas for this quarter will be primarily Medical-Surgical Nursing, with some students assigned to specialty areas. VN300–Medical/SurgicalNursingII–96ClockHours/9.5QuarterCreditHours Prerequisite: Completion of VN 200, VN 210, and VN 220 with 77% or higher. Concurrent enrollment is required with all Module III VN courses. Corequisite: This course is paired with VN 320. Failure in one paired course equals failure in both paired courses. This course covers more advanced pathology, signs, symptoms, incidence, methods of diagnosis, treatment, and medical and surgical conditions. This course examines disrupted endocrine, urinary, reproductive, neurologic, musculoskeletal, and integumentary functions. VN310–PharmacologyII–48ClockHours/4.5QuarterCreditHours Prerequisite: Completion of VN 200, VN 210, and VN 220 with 77% or higher. Concurrent enrollment is required with all Module III VN courses. This course is the second of two required courses in Pharmacology discussing medications affecting the pulmonary system, Digestive System, Hormonal balance, and musculoskeletal system. Antibiotics, Pain-managementdrugs,anddrugsimpactingthecentralnervoussystemwillbecoveredindetail. VN320–ClinicalIII–278ClockHours/9QuarterCreditHours Prerequisite: Completion of VN 200, VN 210, and VN 220 with a “C” or higher. Concurrent enrollment is required with all Module III VN courses. Corequisite: This course is paired with VN 300. Failure in one paired course equals failure in both paired courses. 313

This course allows students to continue to relate theory to practice in a supervised situation and sharpen their clinical skills. The student’s ability to provide safe and effective nursing care is evidenced by meeting specific behavioral objectives in each clinical area. The student’s progress is documented on the Counseling/Probation form. Clinical areas for this quarter will be medical, surgical, and other specialty focuses. VN400–ObstetricalNursing–44ClockHours/4QuarterCreditHours Prerequisite: Completion of VN 300, VN 310, and VN 320 with 80% or higher. Concurrent enrollment is required with all Module IV VN courses. This course emphasizes the total care of the obstetrical client, including the therapeutic uses and effects of drugs during pregnancy, labor and delivery, the immediate postpartum period, and nutrition related to pregnancy and lactation. Care of the newborn is included. The role of the family and the importance of bondingarestressed.Clinical experience and client-centered conferences reinforce classroom theory. VN410–PediatricNursing–44ClockHours/4QuarterCreditHours Prerequisite: Completion of VN 300, VN 310, and VN 320 with a “B” or higher. Concurrent enrollment is required with all Module IV VN courses. This course introduces pediatric nursing through theory. The focus is on meeting the pediatric clients’ and families’ basic human needs, utilizing critical thinking, therapeutic communication, technical skills, leadership/management skills, effective time management, and the nursing process. Professionalism and caring are emphasized. The practical nurse’s role in growth and development, health promotion, and illness prevention is discussed and demonstrated. The didactic focus is on the most common illnesses and conditions the nurse will likely encounterwhileworkingwithchildrenandtheirfamiliesintheacutecaresetting. VN420–PsychiatricNursing–32ClockHours/3QuarterCreditHours Prerequisite: Completion of VN 300, VN 310, and VN 320 with 80% or higher. Concurrent enrollment is required with all Module IV VN courses. This course offers an overview of the practical nurse’s role in preventing and treating mental illness, nursing management ofneuroticandpsychoticclients,clientswithorganicbrainsyndrome,andsuicidalclients.Clinical experience consists primarily of observation. VN430–ClinicalIV–278ClockHours/9QuarterCreditHours Prerequisite: Completion of VN 300, VN 310, and VN 320 with 80% or higher. Concurrent enrollment is required with all Module IV VN courses. This portion of the curriculum allows the student to relate theory to clinical practice in a supervised situation in maternity, pediatric, and psychiatric rotations. The student’s ability to provide safe and effective nursing care to selected clients with minimum supervision by the clinical instructor is evidenced by meeting specific behavioral objectives in each clinical area. VN440–PreparationforNCLEX–40ClockHours/4QuarterCreditHours Prerequisite: Completion of VN 300, VN 310, VN 320, VN 400, VN 410, VN 420, and VN 430 with 80% or higher. Concurrent enrollment is required with all Module IV VN courses. This course covers the application of critical thinking and test-taking strategies in preparing nursing students for licensure success. The course is based on the most current NCLEX Test Plan, addressing patient safety, provision of effective care in a healthcare environment, promotion and maintenance, and physiological and psychosocial integrity. Content includes the nursing process, fundamentals of care in nursing, communication with psychiatric clients, nursing care for children, women of childbearing age, the elderly, medical-surgical clients, and more. X-ray Technician with Medical Assistant Skills (XTMAS) Courses – Blended Program 314

MXT96–MedicalTerminology–28ClockHours/2QuarterCreditHours Prerequisite: None This course introduces Basic Word Structures and reviews them as they apply to the Organization of the Body. ThefoundationalelementsincludeWordRoots,WordParts,Suffixes,andPrefixes.Studentsreinforcethe knowledgebypracticingquizzesandlisteningtoandvocalizingterminologyformemorization.Studentsapply learned terminology to patient case studies. MXT97–BackOfficeClinicalFoundation–68ClockHours/4.5QuarterCreditHours Prerequisite: None This course introduces students to clinical patient care. Students practice professional medical communication with patients and colleagues. Students are taught minor surgery assistance procedures, including setting up, instrument sterilization, and autoclave technique. They learn aseptic medical practice as OSHA requires for exposurecontrolandmedicalwastedisposal. Pharmacologicterminologyandabbreviationsarepracticed.Studentsreviewmathskillstocalculatedosages correctly and convert grams and ounces for medicine administration. Aseptic practice is reinforced throughout all patient interaction procedures. MXT98–BackOfficeClinicalSkills–68ClockHours/4.5QuarterCreditHours Prerequisite: Completion of MXT 97 with a “C” or better. This course introduces students to the back office clinical skills associated with a physical examination. The principles of medical ethics are explored, including guarding information privacy and protecting Patient Rights. Thestructure, function, physiology, and major diseases of the cardiovascular, respiratory, digestive, eye, and ear sensesystemsaretaughtinthiscourse. Additionally, students practice diagnostic tests for each body system and review associated drugs, lab tests, diagnostic studies, and treatment courses. Students will study First Aid and earn CPR Basic Life Support certification through the American Heart Association (AHA BLS for Healthcare Providers). MXT99–BackOfficeClinicalLaboratory–68ClockHours/4.5QuarterCreditHours Prerequisite: Completion of MXT 98 with a “C” or better. This course introduces students to safety practices, including asepsis and biohazard waste disposal. Students will review the purpose and categories of laboratory tests, including collecting, transporting, and handling specimens.Studentswilllearnaboutpediatrichealthmanagement,includingmeasuringheightandweight, specimencollection, immunization schedules, and medicine administration. Therelationship between the humanbody’sbloodchemistry,microbiology,andnutritionalneedsand processes is explored. The major diseases of the urinary, endocrine, and reproductive systems are reviewed in this course as they relate to the diagnostic tests, associated drugs, laboratory tests, diagnostic studies, and treatmentcourses. XT110C–ClinicalPracticeI–160ClockHours/5QuarterCreditHours Prerequisite: Completion of Module II with a “C” or better. This course provides 160 hours of supervised clinical instruction and experience in an approved x-ray departmentofanauthorizedclinicalfacility concentrating on the chest, extremity, and torso-skeletal radiography categories. Back office and medical skills are also included. Students must meet attendance requirementsandsatisfactorily complete the externship objectives. This course helps prepare students for the limited permit x-ray technician certification examination required by theStateofCalifornia Department of Health. This course may include out-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. 315

XT111–RadiographicPatientCare–42ClockHours/4QuarterCreditHours Prerequisite: None This course introduces students to basic imaging principles and patient care. Students review medical ethics, pediatrics, and geriatrics patient care. The duties and responsibilities of working in Radiology are also presented, emphasizing communication and relationships. A review of infection control and standard and transmission-based precautions are covered. This course will include out-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. A minimum of 20 hoursofworkoutsideclasswillbeassigned. XT112–RadiationPhysicsandExposure–58ClockHours/5QuarterCreditHours Prerequisite: None This course teaches the nature and characteristics of radiation, x-ray production, and the fundamentals of photoninteractions with matter. Content provides basic information about electricity, magnetism, and electromagnetismandappliestheseprinciplestothex-raycircuit.Thiscoursewillincludeoutside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. A minimum of 25 hours of work outside class will be assigned. XT113–RadiographicProceduresI–48ClockHours/4.5QuarterCreditHours Prerequisite: None This course introduces the medical terminology, anatomy, physiology, and common chest, thorax, and upper extremities pathologies. Routine chest, bony thorax, and upper extremity radiographic procedures are described and demonstrated. Students demonstrate competency in performing routine radiographic proceduresduringsimulatedradiographicexaminations.Thiscoursewillincludeoutside-of-school preparation hourssuchasreadingandwritingassignments,practiceandpracticalassignments,andprojects.Aminimumof 30hoursofworkoutsideclasswillbeassigned. XT113L–RadiographicProceduresILab–30ClockHours/1.5QuarterCreditHours Prerequisite: None This course provides the knowledge to perform standard imaging of the respiratory system, bony thorax, and upperextremities. Consideration will be given to the production of images of optimal diagnostic quality. Course methodswillincorporatedemonstrations,imageanalyses,andpositioninglabpracticum.Studentsmust demonstratecompetencyinpositioningskills, equipmentmanipulation,andradiationprotectionbefore performingtheseskills under direct supervision in the patient care setting. XT120C–ClinicalPracticeII–160ClockHours/5QuarterCreditHours Prerequisite: Completion of XT 110C with a “C” or better. This course provides 160 hours of supervised clinical instruction and experience in an approved x-ray departmentofanauthorizedclinicalfacility concentrating on chest, extremity, and torso skeletal radiography. Backoffice and medical skills are also included. Students must meet attendance requirements and satisfactorily completetheexternshipobjectives. This course helps prepare students for the limited permit x-ray technician certification examination required by theStateofCalifornia Department of Health. This course may include out-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. XT121–RadiationProtectionandBiology–70ClockHours/6QuarterCreditHours Prerequisite: Completion of Module I with a “C” or better. This course teaches proper radiation protection for the operator and the patient. The performance of ALARA is emphasized.Regulatorystandardsofradiographicproceduresemployingappropriateradiationsafetywillbe identified. This course includes outside-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. A minimum of 30 hours of work outside class will beassigned. 316

XT122–DigitalImaging–52ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module I with a “C” or better. This course introduces students to x-ray imaging, image quality, and exposure factors contributing to producing aradiographic image. The course focuses on the components and principles of exposure, image evaluation, and operation of digital imaging systems in diagnostic radiography. Topics such as image acquisition, display, archiving, and retrieval are discussed. The principles of digital system quality assurance and maintenance will also be presented. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical assignments, and projects. A minimumof22.5hoursofworkoutsideclasswillbeassigned. XT123–RadiographicProceduresII–48ClockHours/4.5QuarterCreditHours Prerequisite: Completion of Module I with a “C” or better. This course introduces medical terminology, anatomy, physiology, and common lower extremity and spine pathologies. Routine radiographic procedures are described and demonstrated for the cervical, thoracic, lumbar, sacroiliac joints, sacrum, coccyx, foot, lower leg, knee, upper leg, hip, and pelvis. Duringsimulatedradiographicexaminations,studentsdemonstratecompetencyinperformingroutine vertebral column and lower extremity radiographic procedures. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical assignments, and projects. A minimumof17.5hoursofworkoutsideclasswillbeassigned. XT123L–RadiographicProceduresIILab–30ClockHours/1.5QuarterCreditHours Prerequisite: Completion of Module I with a “C” or better. This course provides a knowledge base necessary to perform standard radiographic procedures of the bony pelvis, lower extremities, and vertebral column. Consideration will be given to the production of images of optimal diagnostic quality. Course methods will incorporate demonstrations, image analyses, and positioning lab practicum. Students will be required to demonstrate competency in positioning skills, equipment manipulation, and radiation protection before they are allowed to perform these skills under the direct supervision of the patient. XT124–IntegrationofTheoryandPractice–25ClockHours/1QuarterCreditHour Prerequisite: Completion of Module I with a “C” or better. This course focuses on activities associated with refining radiographic imaging skills and medical assistant skills application in an x-ray environment. Emphasis is placed on proper positioning, image critique, patient care, and radiation protection. This course will include outside-of-school preparation hours such as reading and writing assignments, practice and practical assignments, and projects. A minimum of five (5) hours of out-of-class work will be assigned. XT130C–ClinicalPracticeIII–160ClockHours/5QuarterCreditHours Prerequisite: Completion of XT 120C with a “C” or better. This course provides 160 hours of supervised clinical instruction and experience in an approved x-ray departmentofanauthorizedclinicalfacility concentrating on chest, extremities, and torso skeletal radiography. Backoffice and medical skills are also included. Students must meet attendance requirements and satisfactorily completetheexternshipobjectives. This course helps prepare students for the limited permit x-ray technician certification examination required by theStateofCalifornia Department of Health. This course may include out-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. XT140C–ClinicalPracticeIV–120ClockHours/4QuarterCreditHours 317

Prerequisite: Completion of XT 130C with a “C” or better. This course provides 120 hours of supervised clinical instruction and experience in an approved x-ray departmentofanauthorizedclinicalfacility concentrating on chest, extremity, and torso skeletal radiography. Backoffice and medical skills are also included. Students must meet attendance requirements and satisfactorily completetheexternshipobjectives. This course helps prepare students for the limited permit x-ray technician certification examination required by theStateofCalifornia Department of Health. This course may include out-of-school preparation hours such as reading and writing assignments, practice and practical application assignments, and projects. XT150–RadiographySeminar–5QuarterCreditHours Prerequisite: Completion of XT 130C with a “C” or better. This advanced imaging course enforces professionalism, ethics, legal considerations, patient care, patient safety, radiation protection and measurement, image production, radiographic imaging, and image analysis. This course will include outside-of-school preparation hours such as reading and writing assignments, practice andpractical assignments, and projects. A minimum of 25 hours of work outside class will be assigned. Diagnostic Medical Imaging Advanced Clinical Practicum – Continuing Education Courses DMI670C–AdvancedClinicalPracticum(45clockhours) Prerequisite: None This course allows students to perform clinical repetitions in advanced imaging modalities, including MRI, CT, or Mammography. Repetitionswillbedirectlyrelatedtopost-primarycertification exam requirements. This course is repeatable a maximum of three (3) times. International Nurse Graduate Courses – Residential Program RN180–NursingTransitionAdvancedPlacementTheoryandLabCourse(47clockhours=3SemesterUnits Theory, 68 clock hours = 2 Semester Units Lab Prerequisite: None This course introduces students to the roles and responsibilities of the registered nurse and the Associate DegreeNursingProgramframework.EmphasisisplacedonthetransitionfromLVNtoRN,legalandethical responsibilities, nursing process, critical thinking, evidence-based practice, registered nurse competencies, and managementinprimary,secondary,andtertiaryhealthcaresystems. Thelabcomponentofthiscoursefocusesonutilizingthenursingprocess,criticalthinking,andapplyingtheory to skills in various patient case scenarios. The course focuses on dosage calculation, assessment, intravenous administration, central venous access, medication administration, nasogastric feeding, foley catheter insertion, tracheostomycare,andsuctioningskills. RN300–MaternalNewbornTheory(3Units,45clockhours) Prerequisite: None This course comprehensively covers maternal and newborn care, beginning with preconception planning and including risks in pregnancy and postpartum, maternal and newborn complications, male and female reproductive problems and needs, and family needs and problems during the maternity cycle. Concepts of nutrition, cultural variations, and the safety of mothers and newborns are integrated. Therapeutic use of drugs during pregnancy, labor and delivery, and the immediate postpartum period are included. RN301–MaternalNewbornClinical(1.5Units,67.5clockhours) Prerequisite: None 318

This course is taught at a clinical site, applying theoretical content of patient-centered care of mothers and newborns.Theemphasisisonassessment,teaching,andclinicalinterventionstopromotehealthyoutcomes for families. RN302–CareofChildrenTheory(3Units,45clockhours) Prerequisite: None In-depth identification of various diseases affecting the child through young adulthood, including physical and developmentalmaturation,iscovered.Culturalvariations and family interactions are explored. Disease prevention, health maintenance, and appropriate therapeutic interventions such as pharmacologic agents and nutrition are included. RN303–CareofChildrenClinical(1.5Units,67.5clockhours) Prerequisite: None This course is taught at a clinical site, applying theoretical content into practice with attention to patient-centered, quality care. Interaction with family members facilitates the student’s ability to recognize family dynamics and their effects on the developmental process. Advanced skills necessary to care for pediatric patients are achieved through simulation. The application of the nursing process to optimize patient and family outcomesisemphasized. RN304–Medical/SurgicalIIITheory-AdvancedMed/Surg(3Units,45clockhours) Prerequisite: None This course provides basic medical/surgical theory related to respiratory, cardiac, neurologic, and musculoskeletal disorders. Disorders of the following systems are reviewed: integumentary, gastrointestinal, genitourinary, endocrine, sensory, and hematology problems. Developanunderstandingofthedynamicsequenceofbiological,psychological,andsociologicalchangesthat occur through older adulthood. Usual growth and development patterns and disruption in critical periods of developmentarepresentedandhelpdevelopnursinginsight,enablingsafe,effective,patient-centeredcare. RN305–Medical/SurgicalIIIClinical-AdvancedMed/Surg(2Units,90clockhours) Prerequisite: None This course is taught at a clinical site, integrating the practical application of the advanced medical/surgical theory course caring for selected patients with multiple health disruptions. Students apply the nursing process to optimize patient outcomes. RN400–MentalHealthTheory(2Units,30clockhours) Prerequisite: None This course addresses theories and principles of psychiatric nursing. Biopsychosocial foundations of behavior, communication,andpsychopharmacologyareemphasized.Patientrelationshipsandtheuseofeffectiveand ineffective communication are addressed. The nurse’s role in the prevention and early identification of psychiatric disorders of children, adolescents, adults, and older adults and the treatment modalities of mental illness and organic brain syndromes are studied. RN401–MentalHealthClinical(2Units,90clockhours) Prerequisite: None This course is taught at clinical sites, facilitating the application of theory into clinical practice in the care of selected patients who may experience psychological stress, neurobiological disorders, and high-risk situations. This includes homelessness, family violence, child abuse, HIV, and post-traumatic stress syndrome. Students apply the nursing process to optimize patient outcomes. RN402–Medical/SurgicalIVTheory-ComplexMed/Surg&Leadership(3Units,45clockhours) Prerequisite: None 319

This course incorporates previous medical-surgical nursing theory emphasizing the integration of pathophysiology, nutrition, pharmacology, and psychosocial components of safe and individualized care for patients with complex medical-surgical health disruptions. Focusonholistic care for burns, heart failure, acute respiratory distress, shock, multiple organ dysfunction, and traumatic brain injury. Nursing leadership and management are explored in managing complex medical-surgical health alterations. RN403–Medical/SurgicalIVClinical-ComplexMed/Surg&Leadership(2Units,90clockhours) Prerequisite: None This course is taught at a clinical site, integrating the practical application of the advanced medical/surgical theory course caring for selected patients with multiple health disruptions. Students apply the nursing process to optimize patient outcomes. POLICIESSPECIFICTONEVADASTUDENTS ACADEMYLOCATIONS&GENERALDESCRIPTIONOFFACILITIES NevadaDistanceEducationFacilityLocation 6390W.CheyenneAvenue,SuiteF-3 Las Vegas, NV 89108 (725) 218-1600 TheSanJosemaincampushasadistanceeducationfacility(officespace)inLasVegas,Nevada.Thisfacility provides distance education to students in Nevada. However, no instruction is administered at the facility, and programenrollmentisthroughtheSanJosemaincampus. ACCREDITATION,APPROVAL,RECOGNITION,MEMBERSHIP Gurnick AcademyofMedicalArtsislicensedtooperatebytheNevadaCommissiononPostsecondaryEducation andisauthorizedtoofferdegreeprograms.Theprogramsareofferedviadistanceeducation,andthefacilityin Nevadaisadistanceeducationfacility. LICENSURE,CERTIFICATION,®ISTRYDISCLAIMER Graduatesfromthisinstitution’s programs may wish to obtain additional credentials besides the educational credentials obtained from completing their program of study. Certifications are available for all the institution’s programs.NevadadoesnotrequireMRItechnologiststoobtainanylicenseorcertificationfortheAssociateof Science in MRI program. Outsideagenciescontrollicensing examinations and their content. Gurnick Academy of Medical Arts cannot guaranteethatgraduateswillpasstheirlicensing examinations. Registration or license requirements for taking andpassingtheexaminationarenotcontrolledbyGurnickAcademyofMedicalArtsbutbyoutsideagencies. TheyaresubjecttochangebytheagencywithoutnoticetoGurnickAcademyofMedicalArts.Therefore, Gurnick AcademyofMedicalArtscannotguaranteethatgraduateswillbeeligibletotakelicensingcertification examsatanyspecifictime,regardlessoftheireligibility status upon enrollment. 320

Thespecific programmatic accreditation of Gurnick Academy of Medical Arts programs often impacts program graduates’ eligibility. Several of Gurnick Academy of Medical Arts’ programs possess appropriate programmatic accreditations that meet certifying agency educational requirements. Please refer to the individual program listings in this catalog to determine the programmatic accreditation standing of a specific program. ProgramsSpecificLicensure, Certification & Registry Disclaimer Associate of Science in MRI Program (A.S. in MRI) GraduatesoftheAssociateofScienceinMRIProgramcansitfortheARRT®(MR)exam. FINANCIALPOLICIES REFUND If Gurnick Academy of Medical Arts has substantially failed to furnish the training program agreed upon in the enrollment agreement, Gurnick AcademyofMedicalArtsshallrefundallthemoneythestudenthaspaid. If a student cancels their enrollment before the start of the training program or within three (3) days after signing the Enrollment Agreement, Gurnick Academy of Medical Arts shall refund the student all the money thestudenthaspaid. Cancellation may occur when the student provides a written or oral cancellation notice to the campus. This canbedoneelectronically, by mail, hand delivery, or over the phone. The written notice of cancellation, if sent by mail, is effective when deposited in the mail and properly addressed with proper postage. The written notice of cancellation need not take any particular form and is effective if it shows that the student nolongerwishestobeboundbytheEnrollmentAgreement. If a student withdraws or is expelled by Gurnick Academy of Medical Arts after the start of the training program andbeforethecompletionofmorethan60percentoftheprogram,GurnickAcademyofMedicalArtsshall refund the student a pro rata amount of the tuition agreed upon in the enrollment agreement, minus 10 percent of the tuition agreed upon in the enrollment agreement or $100, whichever is less. If a student withdraws or is expelled by Gurnick Academy of Medical Arts after completing more than 60 percent of the training program, Gurnick Academy of Medical Arts is not required to refund the student any money.Itmaychargethestudenttheentirecostofthetuitionagreeduponintheenrollmentagreement. If a refund is owed, Gurnick Academy of Medical Arts shall pay the refund to the person or entity who paid the tuition within 15 calendar days after whichever is applicable: 1. Dateofcancellation by a student of their enrollment; 2. Dateofterminationbytheinstitutionofstudentenrollment; 3. Last day of an authorized leave of absence if a student fails to return after the period of authorized absence; or 4. Last day of attendance of a student. Books, educational supplies, or equipment for individual use are not included in the policy for refund, and Gurnick AcademyofMedicalArtsmustpayaseparaterefundtothestudentifthestudentdidnotusethose items. The administrator must resolve disputes for refunds on a case-by-case basis. 321

For this section: 1. A student’s attendance period must be measured from the first day of instruction as outlined in the enrollment agreementthroughthestudent’slastdayofactualattendance,regardlessofabsences. 2. Theperiodforatrainingprogramisoutlinedintheenrollmentagreement. 3. Tuition must be calculated using the tuition and fees outlined in the enrollment agreement and does not include books, educational supplies, or equipment listed separately from the tuition and fees. If Gurnick Academy of Medical Arts cancels or changes a training program agreed upon in the enrollment agreement,GurnickAcademyofMedicalArtswill: 1. Offer the student a fair chance to complete the same program or another program with a demonstratedpossibility of placement equal to or higher than the possibility of placement of the programinwhichthestudentisenrolledwithinapproximatelythesameperiodatnoadditional cost, if available, or 2. Obtaining the student’s written agreement to the specified changes and a statement that the student is not being coerced or forced into accepting the changes unless the cancellation or change of a program is in response to a change in the requirements to enter an occupation. ACCOUNTFORSTUDENTINDEMNIFICATION Under NRS 394.553, the Nevada Commission on Postsecondary Education has established an account for student indemnification, which may be used to indemnify a student or enrollee who has suffered damage as a result of an institution’s: ● Discontinuanceofoperationofapostsecondaryeducationalinstitutionlicensedinthisstate;or ● ViolationbysuchaninstitutionofanyprovisionofNRS394.383to394.560,inclusive,ortheregulations adoptedunderthat. In addition to the expenditures made for indemnification, the money in the Account may be used to pay extraordinary expenses incurred to investigate claims for indemnification or resulting from discontinuing the operation of a postsecondary educational institution licensed in this state. STUDENTCODEOFCONDUCT DRUG-FREE Local, State, and Federal Legal Sanctions LawsGoverningAlcohol,ControlledSubstances&HealthRisks Aviolation of any law regarding alcohol and controlled substances violates the Student Code of Conduct. It will be treated as a separate disciplinary matter. Druguseduringpregnancymayresultinfetaldamageandcongenitaldisabilities,causinghyperactivity, neurological abnormalities, and developmental difficulties. PREGNANCY Gurnick AcademyofMedicalArtsprovidesallstudentswithasafeenvironmentforclinicalexperiencesand training. In compliance with regulations regarding pregnant students, female students have the option to 322

informprogramofficials whether they are pregnant. With written notification to the Program Director, the student maychangefromoneoptiontoanotherduringthepregnancyifallprogramobjectives,courses,and competenciesarecompleted.However,ifastudentchoosestodeclareherpregnancytoprogramofficials,she mustprovidewrittennotification. Astudentmaysubmitawrittenrequesttowithdrawherdeclarationwithoutquestionatanytime.Astudent whohasdecidedtodeclareherpregnancywillbeallowedtochooseoneofthefollowingoptionsfor completingthetraining at Gurnick Academy of Medical Arts. Options 1. Continuing the training without modification or interruption. This option means that the student agrees to attend and complete all classes, clinical assignments, and competencies in a manner consistent with her peers within the guidelines set forth by the instructors and Gurnick Academy of Medical Arts. The student must present a letter from a physician releasing the student to continue training with Gurnick Academy of Medical Arts, reserving the right to contact the physician to verify the student’s physical activity level and ability to complete all requirements of the clinical experience. 2. The student may take a leave of absence for such a long period as is deemed medically necessary by the student’s physician, at the end of which the student shall be reinstated to the status she held when the leave began. The student must make up all missed clinical and didactic hours and complete all the necessary competencies. This option timing is contingent upon an available student position in an appropriate clinical facility. For students in the Associate of Science in Magnetic Resonance Imaging Program, there is an additional option: 3. Students may also continue the training with a modification of clinical assignments. This option means the student may delay clinical assignments or competencies in areas with potentially hazardous exposure. However, to accomplish this, the training may need to be extended. The student must make up all missed clinical and didactic hours and complete all the necessary competencies. The student will present a letter from a physician releasing the student to continue in training. STUDENTGRIEVANCEANDAPPEALS Our academy is dedicated to fair treatment and professional conduct with students. In compliance with Office of Civil Rights (OCR) recommendations, this policy and procedure about grievances of various natures, including but not limited to academic discrimination, harassment, and bullying. Students are first encouraged to discuss any concerns or questions regarding policies or decisions rendered directly with the party with whomthestudenthasaconcern. Should any student have a complaint, the student is asked to discuss the matter within five days directly with an Instructor or Administrative Manager/Designated School Official, who will initiate an informal process to settle the dispute in good faith. That informal process will involve three steps: 1. Aneffort to define the problem 2. Aneffort to identify acceptable options for resolution 3. An attempt to resolve the conflict through the application of one or more acceptable options for resolution If, as a result of these discussions, the student does not feel that the issue has been satisfactorily resolved, they may, within five (5) days, file a written complaint directly with the Program Director, who will do their best to resolve the matter at hand for the student and the academy. The Program Director will try to resolve or alleviate the complaint or grievance that the student presents within five (5) days of receipt. If, after following these steps, the Program Director cannot remedy the issue and the student is still unsatisfied with the solution, 323

then the Campus Director will investigate all written complaints, attempt to resolve all such complaints, and record an entry into the campus’s official log. The formal process will require the student’s submission of a written description of the specific complaint and the desired remedy, accompanied by any available documentation. The Campus Director will have five (5) days to respond to the grievance and determine a proper action. The Campus Director may notify the student of the decision reached. Students may also follow the Appeals Procedures outlined below for further action if necessary. To provide students with a neutral mechanism for the reconsideration of disciplinary actions or performance evaluations that would necessitate the dismissal of the student from a program, Gurnick Academy of Medical Arts has a designated Appeals Committee consisting of the following individuals: Chief Academic Officer, Chief Operations Officer, Chief Executive Officer, and Vice President, Campus Operations. Note: A student must stay within the appeal process and only contact the Appeal Committee members if directed by a Campus Director or Committee member. A student who goes outside the procedure of this policy will be denied their appeal. If the Campus Director cannot remedy the issue and the student is still unsatisfied with the outcome, the student may ask the Campus Director, in writing, to forward all written grievances and correspondence to the Appeals Committee. The Appeals Committee will have five (5) working days to respond to the appeal and determineapropercourseofaction. All grievances and appeals will be handled discreetly. Dissemination of the resolution will be at the discretion of the Campus Director or Appeals Committee and on a “need-to-know” basis. The decisions rendered by the AppealsCommitteewillbethefinalandbindingdecisionoftheacademy. Students may be withdrawn either by self-withdrawal or by academic withdrawal. A student who self-withdraws will be processed through the drop process. Students who are academically withdrawn may dispute the withdrawal through the student grievance and appeals process. To initiate the grievance and appeals process, the students must submit a written appeal within five (5) days of being notified of the withdrawal. After five (5) days, the student will be dropped via the drop process if no written appeal has been submitted. If a written appeal is submitted within the allotted time, the student grievance and appeals process will start, and the student will be placed on Active Warning status and must attend all instruction until the grievance and appeals process has been completed and a final decision has been made. Please see the Student Grievance and Appealssectionfordetailedinformation. Students enrolled in licensed, private postsecondary institutions may register a legitimate complaint with the CommissiononPostsecondaryEducation. Before filing a complaint, you must attempt to resolve the issue with school officials according to the policies of theschoolwhichyouareattending.Ifyoucannotreachasolution,youmaycontacttheCommission,andthey will attempt to resolve the issue. If a resolution cannot be reached, you will be required to complete a formal complaint form; formal complaints are investigated by staff, and the administrator of the Commission decides. If either party does not agree with that decision, an appeal to the full Commission may be requested: NRS394.520allowsforthefollowing: 324

1. Afull refund can be ordered if it is determined that the school substantially failed to furnish the education agreed to in the enrollment contract; 2. One-half of all monies paid can be ordered if it is determined that the school substantially furnished theeducationstatedintheenrollmentcontract.Still, the conditions were substandard to the point the student could not be expected to complete the training. Moreinformation,includingcomplaintsforms,canbefoundatwww.cpe.nv.gov.Orcontact: CommissiononPostsecondaryEducation 1860EastSaharaAvenue,LasVegas,NV89104 702-486-7330(Phone)|702-486-7340(Fax) STUDENTSERVICES ConsumerProtection Gurnick Academy of Medical Arts has not entered into a transfer or articulation agreement with any other college or university. As a prospective student, you should review this catalog before signing an enrollment agreement. PROGRAMDELIVERY The Associate of Science in MRI delivery method is blended. Lectures and labs are held online, and clinical/practicum is at an assigned clinical site(s). USANDNEVADACONSTITUTION Under NRS 394.150, the Nevada Commission on Postsecondary Education requires that all private schools, colleges, and universities located within the state of Nevada, except those operated exclusively for employees of the Department of Defense of the Federal Government and their families, provide instruction in the essentials of the Constitution of the United States and the Constitution of the State of Nevada, including the origin and history of the Constitutions and the study of and devotion to American institutions and ideals. Students who reside in Nevada must receive instruction on the US and Nevada Constitution and pass an examinationduringorientation. COURSEDESCRIPTIONS Orientation–DistanceEducation(Online) SNO001–USandNevadaConstitution–Pass/NoPass Prerequisite: None The instruction on the United States Constitution and the Nevada State Constitution provides the student with the essentials of the two (2) Constitutions, which gives the learner an overview of the elements, similarities, anduniqueaspectsofeach. NOTE:PleasereviewtheattachedAddendumforanychangesandupdatesthatwemayhaveregardingour programsandtheAcademyasawhole. 325